HADHB Antibody - C-terminal region (ARP48133_P050)

Data Sheet
 
Product Number ARP48133_P050
Product Page www.avivasysbio.com/hadhb-antibody-c-terminal-region-arp48133-p050.html
Name HADHB Antibody - C-terminal region (ARP48133_P050)
Protein Size (# AA) 474 amino acids
Molecular Weight 47kDa
Subunit beta, mitochondrial
NCBI Gene Id 3032
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit
Description
Alias Symbols ECHB, MTPB, MSTP029, TP-BETA
Peptide Sequence Synthetic peptide located within the following region: LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wang,R., (2006) Zhonghua Fu Chan Ke Za Zhi 41 (10), 672-675
Description of Target HADHB is the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in HADHB gene result in trifunctional protein deficiency. The protein can also bind RNA and decreases the stability of some mRNAs.This gene encodes the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in this gene result in trifunctional protein deficiency. The encoded protein can also bind RNA and decreases the stability of some mRNAs. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. Alternatively spliced transcript variants have been found; however, their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions HUWE1; TP53; TUBG1; SUMO2; SUMO3; UBC; PARK2; PPP6R1; ADRB2; CSNK2A2; PAN2; ATF2; vpu; TIMM8B; COX17; IQCB1; SUOX; CHCHD4; TUBB1; RPS8; OPA1; HSP90AB1; HADHA; DES; GRK5; FBXO6; CDK2; LEO1; RTF1; TK1; SMN1; PSMA3; GRB7; RCC1; CDKN1A; ANXA7; Edc4; MYC; SQST
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-HADHB (ARP48133_P050) antibody
Additional Information IHC Information: Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
Blocking Peptide For anti-HADHB (ARP48133_P050) antibody is Catalog # AAP48133 (Previous Catalog # AAPP28649)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HADHB
Uniprot ID P55084
Protein Name Trifunctional enzyme subunit beta, mitochondrial
Publications

Defining decreased protein succinylation of failing human cardiac myofibrils in ischemic cardiomyopathy. J Mol Cell Cardiol. 138, 304-317 (2020). 31836543

Gerin, I. et al. Expression of miR-33 from an SREBP2 intron inhibits cholesterol export and fatty acid oxidation. J. Biol. Chem. 285, 33652-61 (2010). 20732877

The nuclear receptor FXR uncouples the actions of miR-33 from SREBP-2. Arterioscler Thromb Vasc Biol. 35, 787-95 (2015). 25593129

TXNIP regulates myocardial fatty acid oxidation via miR-33a signaling. Am. J. Physiol. Heart Circ. Physiol. 311, H64-75 (2016). 27199118

Sample Type Confirmation

HADHB is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_000174
Purification Affinity Purified
Nucleotide Accession # NM_000183
Tested Species Reactivity Human
Gene Symbol HADHB
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Yeast: 83%; Zebrafish: 86%
Image 1

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com