CD36 Antibody - N-terminal region (ARP48127_P050)

Data Sheet
 
Product Number ARP48127_P050
Product Page www.avivasysbio.com/cd36-antibody-n-terminal-region-arp48127-p050.html
Name CD36 Antibody - N-terminal region (ARP48127_P050)
Gene Symbol CD36
Alias Symbols CHDS7, FAT, GP3B, GP4, GPIV, PASIV, SCARB3, BDPLT10
Protein Size (# AA) 472 amino acids
Molecular Weight 53kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 948
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name CD36 molecule (thrombospondin receptor)
Peptide Sequence Synthetic peptide located within the following region: KTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQV
Target Reference Bhr,C., (2008) Hum. Mol. Genet. 17 (11), 1695-1704
Description of Target CD36 is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in its gene cause platelet glycoprotein deficiency. The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Protein Interactions CHRD; APP; CAND1; ITGA2B; MATK; SRC; THBS1; ITGB3; LYN; YES1; ITGA6; CD9; FYN; ITGB1; COL1A2; COL1A1; VLDLR; LDLR; HSD11B1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CD36 (ARP48127_P050) antibody
Blocking Peptide For anti-CD36 (ARP48127_P050) antibody is Catalog # AAP48127 (Previous Catalog # AAPP28011)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CD36
Complete computational species homology data Anti-CD36 (ARP48127_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CD36.
Swissprot Id P16671
Protein Name Platelet glycoprotein 4
Protein Accession # NP_001001547
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CD36.
Nucleotide Accession # NM_001001547
Replacement Item This antibody may replace item sc-13572, HPA002018
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human Liver
WB Suggested Anti-CD36 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver
Image 2
Human Fetal Heart
Host: Rabbit
Target Name: CD36
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml
Image 3
Human Fetal Liver
Host: Rabbit
Target Name: CD36
Sample Type: Human Fetal Liver
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 1ug/ml
Peptide Concentration: 5ug/ml
Lysate Quantity: 25ug/lane/lane
Gel Concentration: 0.12
Image 4
Mouse Gut
Mouse Gut
Image 5
Human HepG2 Whole Cell
Host: Rabbit
Target Name: CD36
Sample Tissue: Human HepG2 Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com