IL28RA Antibody - N-terminal region (ARP48069_P050)

• Product Number: ARP48069_P050
• Name: IL28RA Antibody - N-terminal region (ARP48069_P050)
• Protein Size (# AA): 491 amino acids
• Molecular Weight: 57 kDa
• Subunit: alpha
• NCBI Gene Id: 163702
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Interleukin 28 receptor, alpha (interferon, lambda receptor)
• Alias Symbols: IFNLR, LICR2, IL28RA, CRF2/12, IL-28R1
• Peptide Sequence: Synthetic peptide located within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Chae,S.C., (2006) Exp. Mol. Med. 38 (3), 302-309
• Description of Target: IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
• Protein Interactions: IFNLR1; IFNL1; IFNL2; LSM8;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-IFNLR1 (ARP48069_P050) antibody is Catalog # AAP48069 (Previous Catalog # AAPS21112)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL28RA
• Uniprot ID: Q5VTX8
• Protein Name: Interleukin-28 receptor subunit alpha
• Publications:

  Mucha, J., Majchrzak, K., Taciak, B., Hellmén, E. & Król, M. MDSCs mediate angiogenesis and predispose canine mammary tumor cells for metastasis via IL-28/IL-28RA (IFN-λ) signaling. PLoS One 9, e103249 (2014). 25075523

• Protein Accession #: NP_775087
• Purification: Affinity Purified
• Nucleotide Accession #: NM_173064
• Tested Species Reactivity: Human
• Gene Symbol: IFNLR1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 77%; Rabbit: 86%; Rat: 92%
• Image 1: Human Fetal Lung
  
  Host: Rabbit
  Target Name: IL28RA
  Sample Tissue: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 2: Human Ovary, MCF7
  
  Host: Rabbit
  Target: IFNLR1
  Positive control (+): Human Ovary (OV)
  Negative control (-): MCF7 (N10)
  Antibody concentration: 0.5ug/ml
• Image 3: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. A ~35 kDa isoform also contains this peptide.