AKT1S1 Antibody - C-terminal region (ARP48061_P050)

Data Sheet
 
Product Number ARP48061_P050
Product Page https://www.avivasysbio.com/akt1s1-antibody-c-terminal-region-arp48061-p050.html
Name AKT1S1 Antibody - C-terminal region (ARP48061_P050)
Protein Size (# AA) 256 amino acids
Molecular Weight 27kDa
NCBI Gene Id 84335
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name AKT1 substrate 1 (proline-rich)
Alias Symbols Lobe, PRAS40
Peptide Sequence Synthetic peptide located within the following region: KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Fonseca,B.D., (2008) Biochem. J. 411 (1), 141-149
Description of Target AKT1S1 may play an important role in phosphatidylinositol 3-kinase (PI3K)-AKT1 survival signaling. It is the substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. Its role in survival signaling pathways may be modulated by oxidative stress. AKT1S1 may also play a role in nerve growth factor-mediated neuroprotection.AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).[supplied by OMIM].
Protein Interactions MTOR; RPTOR; SGK1; RICTOR; MAPKAP1; MLST8; FAM114A1; YWHAQ; YWHAB; SQSTM1; RPS6KA5; TCEA2; YWHAG; EIF6; AKT2; AKT1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-AKT1S1 (ARP48061_P050) antibody
Blocking Peptide For anti-AKT1S1 (ARP48061_P050) antibody is Catalog # AAP48061 (Previous Catalog # AAPY02091)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human AKT1S1
Uniprot ID Q96B36
Protein Name Proline-rich AKT1 substrate 1
Protein Accession # NP_115751
Purification Affinity Purified
Nucleotide Accession # NM_032375
Tested Species Reactivity Human
Gene Symbol AKT1S1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
Human heart
Rabbit Anti-AKT1S1 Antibody
Catalog Number: ARP48061_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic in endothelial cells in blood vessels
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 2
Human 293T
WB Suggested Anti-AKT1S1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate