ARRB2 Antibody - middle region (ARP48007_P050)

• Product Number: ARP48007_P050
• Name: ARRB2 Antibody - middle region (ARP48007_P050)
• Protein Size (# AA): 409 amino acids
• Molecular Weight: 46kDa
• NCBI Gene Id: 409
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Arrestin, beta 2
• Alias Symbols: ARB2, ARR2, BARR2
• Peptide Sequence: Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Luan,B., (2005) EMBO J. 24 (24), 4237-4246
• Description of Target: Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. ARRB2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors.Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
• Protein Interactions: UBC; SRC; MAPK9; INSR; AKT1; USP33; ADRB2; TBXA2R; CYTH1; PTGDS; BAI1; LIMK1; CFL1; CSK; AGTR1; MAP2K4; MAPK10; MAP3K5; GCG; NFKBIA; MDM2; IGF1R; CLTC; ADRB1; HIPK3; EDNRA; gag-pol; ARRDC3; ARRDC4; SIRT1; PDE4D; Mlnr; Trhr; C5AR1; SLC9A5; AP2M1; HCRTR1; F
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ARRB2 (ARP48007_P050) antibody is Catalog # AAP48007 (Previous Catalog # AAPS20510)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARRB2
• Uniprot ID: P32121
• Protein Name: Beta-arrestin-2
• Sample Type Confirmation:

  ARRB2 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_945355
• Purification: Affinity Purified
• Nucleotide Accession #: NM_199004
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: ARRB2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human Skin
  
  Human Skin
• Image 2: Human HepG2
  
  Sample Type: HepG2 cell lysate
  Antibody concentration: 1.0 ug/ml
  Gel concentration: 12%.ARRB2 is supported by BioGPS gene expression data to be expressed in HepG2
• Image 3: mouse left ventricle heart
  
  Sample Type:
  Lane 1: 20ug mouse left ventricle heart lysate Primary Antibody Dilution:
  1:1000 Secondary Antibody:
  Anti-rabbit-HRP Secondary Antibody Dilution:
  1:5000 Color/Signal Descriptions:
  ARRB2 Gene Name:
  Kathleen Gabrielson Submitted by: