NR0B1 Antibody - middle region (ARP48005_P050)

Data Sheet
 
Product Number ARP48005_P050
Product Page www.avivasysbio.com/nr0b1-antibody-middle-region-arp48005-p050.html
Name NR0B1 Antibody - middle region (ARP48005_P050)
Protein Size (# AA) 470 amino acids
Molecular Weight 52kDa
NCBI Gene Id 190
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nuclear receptor subfamily 0, group B, member 1
Alias Symbols AHC, AHX, DSS, GTD, HHG, AHCH, DAX1, DAX-1, NROB1, SRXY2
Peptide Sequence Synthetic peptide located within the following region: FCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Mantovani,G., (2005) Fertil. Steril. 84 (5), 1542-1544
Description of Target NR0B1 is a protein that contains a DNA-binding domain. The protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in its gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.
Protein Interactions NR5A1; ESRRG; RORA; RNF31; UBC; NR3C1; ESRRA; SNW1; PPARG; POU5F1; PGR; AR; COPS2; NRIP1; ESR2; SREBF1; ESR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NR0B1 (ARP48005_P050) antibody
Blocking Peptide For anti-NR0B1 (ARP48005_P050) antibody is Catalog # AAP48005 (Previous Catalog # AAPS20508)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NR0B1
Uniprot ID P51843
Protein Name Nuclear receptor subfamily 0 group B member 1
Protein Accession # NP_000466
Purification Affinity Purified
Nucleotide Accession # NM_000475
Tested Species Reactivity Human
Gene Symbol NR0B1
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human HepG2
WB Suggested Anti-NR0B1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com