Product Number |
ARP47976_P050 |
Product Page |
www.avivasysbio.com/ndrg2-antibody-c-terminal-region-arp47976-p050.html |
Name |
NDRG2 Antibody - C-terminal region (ARP47976_P050) |
Protein Size (# AA) |
357 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
57447 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
NDRG family member 2 |
Alias Symbols |
SYLD |
Peptide Sequence |
Synthetic peptide located within the following region: GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Lusis,E.A., (2005) Cancer Res. 65 (16), 7121-7126 |
Description of Target |
NDRG2¡¯s gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth. Its gene may be involved in glioblastoma carcinogenesis.This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. |
Protein Interactions |
CLN8; ATP1B1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NDRG2 (ARP47976_P050) antibody |
Additional Information |
IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 5 ug/ml. |
Blocking Peptide |
For anti-NDRG2 (ARP47976_P050) antibody is Catalog # AAP47976 (Previous Catalog # AAPS20004) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human NDRG2 |
Uniprot ID |
Q9UN36 |
Protein Name |
Protein NDRG2 |
Protein Accession # |
NP_057334 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_016250 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
NDRG2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-NDRG2 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate |
|
Image 2 | Human Liver
| Liver |
|
Image 3 | Mouse Liver
| Host: Mouse Target Name: NDRG2 Sample Tissue: Mouse Liver Antibody Dilution: 1ug/ml |
|
Image 4 | Mouse Liver
| Host: Rabbit Target Name: NDRG2 Sample Tissue: Mouse Liver Antibody Dilution: 1ug/ml |
|