NDRG2 Antibody - C-terminal region (ARP47976_P050)

Data Sheet
 
Product Number ARP47976_P050
Product Page www.avivasysbio.com/ndrg2-antibody-c-terminal-region-arp47976-p050.html
Name NDRG2 Antibody - C-terminal region (ARP47976_P050)
Protein Size (# AA) 357 amino acids
Molecular Weight 39kDa
NCBI Gene Id 57447
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name NDRG family member 2
Alias Symbols SYLD
Peptide Sequence Synthetic peptide located within the following region: GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lusis,E.A., (2005) Cancer Res. 65 (16), 7121-7126
Description of Target NDRG2¡¯s gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth. Its gene may be involved in glioblastoma carcinogenesis.This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Protein Interactions CLN8; ATP1B1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NDRG2 (ARP47976_P050) antibody
Additional Information IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 5 ug/ml.
Blocking Peptide For anti-NDRG2 (ARP47976_P050) antibody is Catalog # AAP47976 (Previous Catalog # AAPS20004)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NDRG2
Uniprot ID Q9UN36
Protein Name Protein NDRG2
Protein Accession # NP_057334
Purification Affinity Purified
Nucleotide Accession # NM_016250
Tested Species Reactivity Human, Mouse
Gene Symbol NDRG2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-NDRG2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human Liver
Liver
Image 3
Mouse Liver
Host: Mouse
Target Name: NDRG2
Sample Tissue: Mouse Liver
Antibody Dilution: 1ug/ml
Image 4
Mouse Liver
Host: Rabbit
Target Name: NDRG2
Sample Tissue: Mouse Liver
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com