Product Number |
ARP47897_T100 |
Product Page |
www.avivasysbio.com/exd-antibody-c-terminal-region-arp47897-t100.html |
Name |
exd Antibody - C-terminal region (ARP47897_T100) |
Protein Size (# AA) |
376 amino acids |
Molecular Weight |
42kDa |
NCBI Gene Id |
32567 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Extradenticle |
Alias Symbols |
anon-EST:fe1H3, CG8933, DExd, Dm-EXD, Dmel\CG8933, Dpbx, Exd, EXD, l(1)IV, lincRNA.S9404, Pbx1, td48 |
Peptide Sequence |
Synthetic peptide located within the following region: EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
As a transcription factor, exd acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless, teashirt and decapentaplegic. Thus exd affects segmental identity. |
Protein Interactions |
CG31957; CG18764; Fer2LCH; CG6454; fzo; ATPsyn-d; hth; CG7443; Dfd; Sec8; CG32425; CG32176; tamo; RpS11; en; nito; E2f2; CG13962; CG7231; Rack1; sip2; Taf12L; dod; Bap60; CG2972; CG12661; MED22; ftz; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-exd (ARP47897_T100) antibody |
Blocking Peptide |
For anti-exd (ARP47897_T100) antibody is Catalog # AAP47897 (Previous Catalog # AAPP27341) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Fruit fly |
Uniprot ID |
P40427 |
Protein Name |
Homeobox protein extradenticle |
Protein Accession # |
NP_727924 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_167479 |
Tested Species Reactivity |
Fruit fly |
Gene Symbol |
exd |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93% |
Image 1 | Drosophila
| exd antibody - C-terminal region (ARP47897_T100) validated by WB using Drosophila EXD constructs at 1:1000. |
|
Image 2 | r-Exd
| Lanes: Lane1: E. coli purified Exd (no tag) Lane2: Cell free expressed Exd (His tag) Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:5000 Gene Name: exd Submitted by: Kimberly Kaufman, Univeristy of Wisconsin-Madison
|
|
Image 3 | Drosophila
| WB Suggested Anti-exd Antibody Titration: 5.0ug/ml Positive Control: Drosophila |
|