exd Antibody - C-terminal region (ARP47897_T100)

Data Sheet
 
Product Number ARP47897_T100
Product Page www.avivasysbio.com/exd-antibody-c-terminal-region-arp47897-t100.html
Name exd Antibody - C-terminal region (ARP47897_T100)
Protein Size (# AA) 376 amino acids
Molecular Weight 42kDa
NCBI Gene Id 32567
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Extradenticle
Alias Symbols anon-EST:fe1H3, CG8933, DExd, Dm-EXD, Dmel\CG8933, Dpbx, Exd, EXD, l(1)IV, lincRNA.S9404, Pbx1, td48
Peptide Sequence Synthetic peptide located within the following region: EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target As a transcription factor, exd acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless, teashirt and decapentaplegic. Thus exd affects segmental identity.
Protein Interactions CG31957; CG18764; Fer2LCH; CG6454; fzo; ATPsyn-d; hth; CG7443; Dfd; Sec8; CG32425; CG32176; tamo; RpS11; en; nito; E2f2; CG13962; CG7231; Rack1; sip2; Taf12L; dod; Bap60; CG2972; CG12661; MED22; ftz;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-exd (ARP47897_T100) antibody
Blocking Peptide For anti-exd (ARP47897_T100) antibody is Catalog # AAP47897 (Previous Catalog # AAPP27341)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Fruit fly
Uniprot ID P40427
Protein Name Homeobox protein extradenticle
Protein Accession # NP_727924
Purification Protein A purified
Nucleotide Accession # NM_167479
Tested Species Reactivity Fruit fly
Gene Symbol exd
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Image 1
Drosophila
exd antibody - C-terminal region (ARP47897_T100) validated by WB using Drosophila EXD constructs at 1:1000.
Image 2
r-Exd
Lanes:
Lane1: E. coli purified Exd (no tag)
Lane2: Cell free expressed Exd (His tag)
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit HRP
Secondary Antibody Dilution:
1:5000
Gene Name:
exd
Submitted by:
Kimberly Kaufman, Univeristy of Wisconsin-Madison
Image 3
Drosophila
WB Suggested Anti-exd Antibody Titration: 5.0ug/ml
Positive Control: Drosophila
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com