| Product Number |
ARP47884_P050 |
| Product Page |
www.avivasysbio.com/antp-antibody-c-terminal-region-arp47884-p050.html |
| Name |
Antp Antibody - C-terminal region (ARP47884_P050) |
| Protein Size (# AA) |
297 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
40835 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Antennapedia |
| Alias Symbols |
3.4, Ant, ANT-C, ANT-P, ANTC, antp, AntP, ANTP, Antp P1, Antp P2, Antp1, AntP1, Aus, BG:DS07700.1, CG1028, DmAntp, DMANTPE1, Dmel\CG1028, DRO15DC96Z, Hu, l(3)84Ba, Ns, Scx |
| Peptide Sequence |
Synthetic peptide located within the following region: QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Antp is a sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. It provides cells with specific positional identities on the anterior-posterior axis. |
| Protein Interactions |
Dsp1; spen; ey; ash2; osa; Ubx; mor; trx; hth; Scr; Dfd; lab; Snr1; Pc; Cpr73D; brm; tna; Zasp66; CG4623; CG16985; CG15120; Pcl; CycE; d; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Antp (ARP47884_P050) antibody |
| Blocking Peptide |
For anti-Antp (ARP47884_P050) antibody is Catalog # AAP47884 (Previous Catalog # AAPP27328) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Fruit fly |
| Uniprot ID |
P02833 |
| Protein Name |
Homeotic protein antennapedia |
| Protein Accession # |
NP_996176 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_206454 |
| Tested Species Reactivity |
Fruit fly |
| Gene Symbol |
Antp |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Fruit fly:100%; |
| Image 1 | Drosophila
 | WB Suggested Anti-Antp Antibody Titration: 0.2-1 ug/ml
Positive Control: Drosophila |
|
|
