eve Antibody - N-terminal region (ARP47848_P050)

• Product Number: ARP47848_P050
• Name: eve Antibody - N-terminal region (ARP47848_P050)
• Protein Size (# AA): 376 amino acids
• Molecular Weight: 40kDa
• NCBI Gene Id: 36039
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Even skipped
• Alias Symbols: 10.5, 10.9, 14.10, 20.35, CG2328, dm-eve, Dmel\CG2328, E(eve), Eve, EVE, eve2, even, F, l(2)46Ce, l(2)46CFg, l(2)46CFh, l(2)46CFj, l(2)46CFp, l(2)46Cg, V, VI
• Peptide Sequence: Synthetic peptide located within the following region: MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Eve may play a role in determining neuronal identity. It may be directly involved in specifying identity of individual neurons. It is a pair-rule protein required for segmentation; involved in transforming the broad, spatial, aperiodic expression patterns of the gap genes into a system of precise periodic expression patterns of the pair-rule and segmentary polarity genes.
• Protein Interactions: kn; Dl; Rad51D; Gug; trol; zfh1; gro; ftz; beat-Ia; CycE;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-eve (ARP47848_P050) antibody is Catalog # AAP47848 (Previous Catalog # AAPS19204)
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Fruit fly
• Uniprot ID: P06602
• Protein Name: Segmentation protein even-skipped
• Protein Accession #: NP_523670
• Purification: Affinity Purified
• Nucleotide Accession #: NM_078946
• Tested Species Reactivity: Fruit fly
• Gene Symbol: eve
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Fruit fly: 100%
• Image 1: Drosophila
  
  WB Suggested Anti-eve Antibody Titration: 0.2-1 ug/ml
  Positive Control: Drosophila