| Product Number |
ARP47827_P050 |
| Product Page |
www.avivasysbio.com/hb-antibody-n-terminal-region-arp47827-p050.html |
| Name |
hb Antibody - N-terminal region (ARP47827_P050) |
| Protein Size (# AA) |
758 amino acids |
| Molecular Weight |
83kDa |
| NCBI Gene Id |
41032 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Hunchback |
| Alias Symbols |
CG9786, Dmel\CG9786, Hb, HB, hbHLH, Hunchback, l(3)85Ah, R-pbx, Rg-bx, Rg-pbx |
| Peptide Sequence |
Synthetic peptide located within the following region: MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Hb is a gap class segmentation protein that controls development of head structures. |
| Protein Interactions |
nos; Larp7; pho; tsl; bnl; ftz; bcd; kni; ple; Kr; pum; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-hb (ARP47827_P050) antibody |
| Blocking Peptide |
For anti-hb (ARP47827_P050) antibody is Catalog # AAP47827 (Previous Catalog # AAPS19007) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a middle region of Drosophila hb
|
| Uniprot ID |
P05084 |
| Protein Name |
Protein hunchback |
| Protein Accession # |
NP_731268 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_169234 |
| Tested Species Reactivity |
Fruit fly |
| Gene Symbol |
hb |
| Predicted Species Reactivity |
Drosophila |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Drosophila: 100% |
| Image 1 | Drosophila
 | WB Suggested Anti-hb Antibody Titration: 0.2-1 ug/ml
Positive Control: Drosophila |
|
|
