FOXD4 Antibody - middle region (ARP47769_P050)

• Product Number: ARP47769_P050
• Name: FOXD4 Antibody - middle region (ARP47769_P050)
• Protein Size (# AA): 439 amino acids
• Molecular Weight: 47kDa
• NCBI Gene Id: 2298
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Forkhead box D4
• Alias Symbols: FKHL9, FOXD4A, FREAC5, FREAC-5
• Peptide Sequence: Synthetic peptide located within the following region: DPASQDMFDNGSFLRRRKRFQRHQPTPGAHLPHPFPLPAAHAALHNPRPG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: FOXD4 contains 1 fork-head DNA-binding domain. The W148R mutation in the forkhead domain of FOXD4, possibly resultsin reduced DNA binding capacity and altered transcriptional activity.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FOXD4 (ARP47769_P050) antibody is Catalog # AAP47769 (Previous Catalog # AAPP28608)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOXD4
• Uniprot ID: Q12950
• Protein Name: Forkhead box protein D4
• Sample Type Confirmation:

  FOXD4 is supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_997188
• Purification: Affinity Purified
• Nucleotide Accession #: NM_207305
• Tested Species Reactivity: Human
• Gene Symbol: FOXD4
• Predicted Species Reactivity: Human, Rat, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Horse: 79%; Human: 100%; Rabbit: 85%; Rat: 79%
• Image 1: Human 721_B
  
  WB Suggested Anti-FOXD4 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: 721_B cell lysateFOXD4 is supported by BioGPS gene expression data to be expressed in 721_B