| Product Number |
ARP47731_P050 |
| Product Page |
www.avivasysbio.com/agxt2l2-antibody-n-terminal-region-arp47731-p050.html |
| Name |
AGXT2L2 Antibody - N-terminal region (ARP47731_P050) |
| Protein Size (# AA) |
450 amino acids |
| Molecular Weight |
50kDa |
| NCBI Gene Id |
85007 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Alanine-glyoxylate aminotransferase 2-like 2 |
| Alias Symbols |
PHLU, AGXT2L2 |
| Peptide Sequence |
Synthetic peptide located within the following region: QNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGSEANDLALRL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Rual,J.F., (2005) Nature 437 (7062), 1173-1178 |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
PHYKPL; VAC14; USO1; SUMO1; NEDD8; POT1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PHYKPL (ARP47731_P050) antibody |
| Blocking Peptide |
For anti-PHYKPL (ARP47731_P050) antibody is Catalog # AAP47731 (Previous Catalog # AAPP28582) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human AGXT2L2 |
| Uniprot ID |
Q8IUZ5 |
| Protein Name |
5-phosphohydroxy-L-lysine phospho-lyase |
| Protein Accession # |
NP_699204 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_153373 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PHYKPL |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Liver
 | WB Suggested Anti-AGXT2L2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver |
|
|
