VARS2 Antibody - middle region (ARP47652_P050)

Data Sheet
 
Product Number ARP47652_P050
Product Page www.avivasysbio.com/vars2-antibody-middle-region-arp47652-p050.html
Name VARS2 Antibody - middle region (ARP47652_P050)
Protein Size (# AA) 1063 amino acids
Molecular Weight 118kDa
NCBI Gene Id 57176
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Valyl-tRNA synthetase 2, mitochondrial (putative)
Alias Symbols VALRS, VARSL, VARS2L, COXPD20
Peptide Sequence Synthetic peptide located within the following region: LERRFSRVQEVVQVLRALRATYQLTKARPRVLLQSSEPGDQGLFEAFLEP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of the protein remains unknown.
Protein Interactions CMTM5; MAL2; SORBS3; ABI2; NCK2; UBC; PIK3CA; ICT1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-VARS2 (ARP47652_P050) antibody
Blocking Peptide For anti-VARS2 (ARP47652_P050) antibody is Catalog # AAP47652 (Previous Catalog # AAPP28513)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human VARS2
Uniprot ID Q5ST30
Protein Name Valine--tRNA ligase, mitochondrial
Protein Accession # NP_065175
Purification Affinity Purified
Nucleotide Accession # NM_020442
Tested Species Reactivity Human
Gene Symbol VARS2
Predicted Species Reactivity Human, Cow, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Pig: 86%; Rat: 79%
Image 1
Human OVCAR-3
WB Suggested Anti-VARS2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: OVCAR-3 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com