ZNF117 antibody - N-terminal region (ARP47632_P050)
Data Sheet
 
Product Number ARP47632_P050
Product Page www.avivasysbio.com/znf117-antibody-n-terminal-region-arp47632-p050.html
Product Name ZNF117 antibody - N-terminal region (ARP47632_P050)
Size 100 ul
Gene Symbol ZNF117
Alias Symbols H-plk, HPF9, MGC22613
Protein Size (# AA) 483 amino acids
Molecular Weight 56kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 51351
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Zinc finger protein 117
Description This is a rabbit polyclonal antibody against ZNF117. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: QCLKTTLSKIFQCNKYVEVFHKISNSNRHKMRHTENKHFKCKECRKTFCM
Description of Target ZNF117 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ZNF117 (ARP47632_P050) antibody is Catalog # AAP47632 (Previous Catalog # AAPP28489)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF117
Complete computational species homology data Anti-ZNF117 (ARP47632_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ZNF117.
Swissprot Id Q03924
Protein Name Zinc finger protein 117
Protein Accession # NP_056936
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ZNF117.
Nucleotide Accession # NM_015852
Conjugation Options

ARP47632_P050-FITC Conjugated

ARP47632_P050-HRP Conjugated

ARP47632_P050-Biotin Conjugated

Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human HT1080
WB Suggested Anti-ZNF117 Antibody Titration: 0.2-1 ug/ml
Positive Control: HT1080 cell lysate
Image 2
Human Adult Placenta
Host: Rabbit
Target Name: ZNF117
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml
Image 3
Human Fetal Lung
Host: Rabbit
Target Name: ZNF117
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com