HSF5 Antibody - middle region (ARP47544_P050)

• Product Number: ARP47544_P050
• Name: HSF5 Antibody - middle region (ARP47544_P050)
• Protein Size (# AA): 596 amino acids
• Molecular Weight: 65kDa
• NCBI Gene Id: 124535
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Heat shock transcription factor family member 5
• Alias Symbols: HSF 5, HSTF 5
• Peptide Sequence: Synthetic peptide located within the following region: SKPSEDTGLATPARYREHRSNSQQGKSPDLHLLVDVACKQERFPKEEELK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: HSF5 may act as a transcriptional factor.
• Protein Interactions: SAMHD1; ACTN1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HSF5 (ARP47544_P050) antibody is Catalog # AAP47544 (Previous Catalog # AAPS22207)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSF5
• Uniprot ID: Q4G112
• Protein Name: Heat shock factor protein 5
• Publications:

  Xu, Y.-M., Huang, D.-Y., Chiu, J.-F. & Lau, A. T. Y. Post-translational modification of human heat shock factors and their functions: a recent update by proteomic approach. J. Proteome Res. 11, 2625-34 (2012). 22494029

• Protein Accession #: NP_001073908
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001080439
• Tested Species Reactivity: Human
• Gene Symbol: HSF5
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
• Image 1: Human ACHN
  
  WB Suggested Anti-HSF5 Antibody Titration: 0.2-1 ug/ml
  Positive Control: ACHN cell lysate