ZSCAN12 Antibody - N-terminal region (ARP47528_T100)

Data Sheet
 
Product Number ARP47528_T100
Product Page www.avivasysbio.com/zscan12-antibody-n-terminal-region-arp47528-t100.html
Name ZSCAN12 Antibody - N-terminal region (ARP47528_T100)
Protein Size (# AA) 604 amino acids
Molecular Weight 66kDa
NCBI Gene Id 9753
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger and SCAN domain containing 12
Alias Symbols ZFP96, ZNF96, ZNF305, ZNF29K1, dJ29K1.2
Peptide Sequence Synthetic peptide located within the following region: QEMFLQETVRLRKEGEPSMSLQSMKAQPKYESPELESQQEQVLDVETGNE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lee,P.L., (1997) Genomics 43 (2), 191-201
Description of Target ZSCAN12 may be involved in transcriptional regulation.
Protein Interactions KRTAP10-1; SSX2IP; ZNF496; CEP70; ZKSCAN7; ZSCAN32; ZNF473; TFIP11; MTUS2; MID2; ZSCAN12; SUMO1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZSCAN12 (ARP47528_T100) antibody
Blocking Peptide For anti-ZSCAN12 (ARP47528_T100) antibody is Catalog # AAP47528 (Previous Catalog # AAPP28365)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZSCAN12
Uniprot ID O43309
Protein Name Zinc finger and SCAN domain-containing protein 12
Protein Accession # NP_001034732
Purification Protein A purified
Nucleotide Accession # NM_001039643
Tested Species Reactivity Human
Gene Symbol ZSCAN12
Predicted Species Reactivity Human, Cow, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 77%; Human: 100%; Pig: 93%
Image 1
Human Jurkat
WB Suggested Anti-ZSCAN12 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com