| Product Number |
ARP47491_T100 |
| Product Page |
www.avivasysbio.com/lhx8-antibody-middle-region-arp47491-t100.html |
| Name |
LHX8 Antibody - middle region (ARP47491_T100) |
| Protein Size (# AA) |
356 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
431707 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
LIM homeobox 8 |
| Alias Symbols |
LHX7 |
| Peptide Sequence |
Synthetic peptide located within the following region: LSTGEEFALVEEKVLCRVHYDCMLDNLKREVENGNGISVEGALLTEQDVN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kitanaka,J., (1998) Genomics 49 (2), 307-309 |
| Description of Target |
LHX8 is a member of the LIM homeobox family. Members of this family share common structural features. They all contain 2 tandemly repeated cysteine-rich double-zinc finger motifs, called LIM domains, in addition to a homeodomain. The homeodomain is a DNA-binding domain, and the LIM domains are essential for regulating the activity of these molecules by interacting with other proteins. Members of the family are required for the patterning or the specification and differentiation of different cell types during embryonic development. |
| Protein Interactions |
NUTM1; SCYL3; KLF3; LDB1; SUV39H1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LHX8 (ARP47491_T100) antibody |
| Blocking Peptide |
For anti-LHX8 (ARP47491_T100) antibody is Catalog # AAP47491 (Previous Catalog # AAPP28329) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LHX8 |
| Uniprot ID |
Q68G74 |
| Protein Name |
LIM/homeobox protein Lhx8 |
| Protein Accession # |
NP_001001933 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001001933 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LHX8 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-LHX8 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate |
|
|
