| Product Number |
ARP47432_P050 |
| Product Page |
www.avivasysbio.com/dram1-antibody-n-terminal-region-arp47432-p050.html |
| Name |
Dram1 Antibody - N-terminal region (ARP47432_P050) |
| Protein Size (# AA) |
238 amino acids |
| Molecular Weight |
28kDa |
| NCBI Gene Id |
71712 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
DNA-damage regulated autophagy modulator 1 |
| Description |
|
| Alias Symbols |
Dram, 1200002N14Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: MLCFLRGMAFVPFLLVTWSSAAFIISYVVAVLSGHVNPFLPYISDTGTTP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Dram1 induces apoptotic cell death when co-expressed with DRAM1. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Dram1 (ARP47432_P050) antibody |
| Blocking Peptide |
For anti-Dram1 (ARP47432_P050) antibody is Catalog # AAP47432 |
| Uniprot ID |
Q9CR48 |
| Protein Name |
DNA damage-regulated autophagy modulator protein 2 |
| Publications |
Manipulation of Autophagy and Apoptosis Facilitates Intracellular Survival of Staphylococcus aureus in Human Neutrophils. Front Immunol. 11, 565545 (2020). 33262756 |
| Protein Accession # |
NP_082154 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_027878 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Dram1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75% |
| Image 1 | Mouse Small Intestine
 | WB Suggested Anti-Dram1 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Small Intestine |
|
|
