KIRREL1 Antibody - middle region (ARP47408_P050)

• Product Number: ARP47408_P050
• Name: KIRREL1 Antibody - middle region (ARP47408_P050)
• Protein Size (# AA): 757 amino acids
• Molecular Weight: 84 kDa
• NCBI Gene Id: 55243
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: kirre like nephrin family adhesion molecule 1
• Alias Symbols: NEPH1, KIRREL, NPHS23
• Peptide Sequence: Synthetic peptide located within the following region: FLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Harita,Y., (2008) J. Biol. Chem. 283 (14), 9177-9186
• Description of Target: NEPH1 is a member of the nephrin-like protein family, which includes NEPH2 (MIM 607761) and NEPH3 (MIM 607762). The cytoplasmic domains of these proteins interact with the C terminus of podocin (NPHS2; MIM 604766), and the genes are expressed in kidney podocytes, cells involved in ensuring size- and charge-selective ultrafiltration (Sellin et al., 2003 [PubMed 12424224]).[supplied by OMIM, Mar 2008]
• Protein Interactions: UBC; SAV1; LATS1; GRB2; KIRREL; NPHS2; NPHS1; TJP1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-KIRREL1 (ARP47408_P050) antibody is Catalog # AAP47408 (Previous Catalog # AAPP28273)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIRREL
• Uniprot ID: Q96J84
• Protein Name: kin of IRRE-like protein 1
• Publications:

  Ito, M. et al. Glycoprotein hyposialylation gives rise to a nephrotic-like syndrome that is prevented by sialic acid administration in GNE V572L point-mutant mice. PLoS One 7, e29873 (2012). 22253810

• Protein Accession #: NP_060710
• Purification: Affinity Purified
• Nucleotide Accession #: NM_018240
• Tested Species Reactivity: Human
• Gene Symbol: KIRREL1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution is 1-3 ug/mL for this antibody.