| Product Number |
ARP47391_P050 |
| Product Page |
www.avivasysbio.com/neto2-antibody-n-terminal-region-arp47391-p050.html |
| Name |
NETO2 Antibody - N-terminal region (ARP47391_P050) |
| Protein Size (# AA) |
525 amino acids |
| Molecular Weight |
57kDa |
| NCBI Gene Id |
81831 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Neuropilin (NRP) and tolloid (TLL)-like 2 |
| Alias Symbols |
BTCL2, NEOT2 |
| Peptide Sequence |
Synthetic peptide located within the following region: ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQME |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824 |
| Description of Target |
NETO2 is a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis. Alternatively spliced transcript variants have been observed, but they have not been fully characterized. |
| Protein Interactions |
ELAVL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NETO2 (ARP47391_P050) antibody |
| Blocking Peptide |
For anti-NETO2 (ARP47391_P050) antibody is Catalog # AAP47391 (Previous Catalog # AAPP28257) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NETO2 |
| Uniprot ID |
Q8NC67 |
| Protein Name |
Neuropilin and tolloid-like protein 2 |
| Sample Type Confirmation |
NETO2 is supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_060562 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018092 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NETO2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human 721_B
 | WB Suggested Anti-NETO2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysateNETO2 is supported by BioGPS gene expression data to be expressed in 721_B |
|
| Image 2 | Human Bronchial Epithelial Tissue
 | Rabbit Anti-NETO2 Antibody
Catalog Number: ARP47391_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
|
|
