| Product Number |
ARP47389_P050 |
| Product Page |
www.avivasysbio.com/tmem16k-antibody-c-terminal-region-arp47389-p050.html |
| Name |
TMEM16K Antibody - C-terminal region (ARP47389_P050) |
| Protein Size (# AA) |
660 amino acids |
| Molecular Weight |
76kDa |
| NCBI Gene Id |
55129 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Anoctamin 10 |
| Alias Symbols |
SCAR10, TMEM16K |
| Peptide Sequence |
Synthetic peptide located within the following region: LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
TMEM16K is a multi-pass membrane protein. It belongs to the anoctamin family. TMEM16K may act as a calcium-activated chloride channel. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ANO10 (ARP47389_P050) antibody |
| Blocking Peptide |
For anti-ANO10 (ARP47389_P050) antibody is Catalog # AAP47389 (Previous Catalog # AAPP28255) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TMEM16K |
| Uniprot ID |
Q9NW15 |
| Protein Name |
Anoctamin-10 |
| Publications |
A Coding Variant of ANO10, Affecting Volume Regulation of Macrophages, Is Associated with Borrelia Seropositivity. Mol. Med. 21, 26-37 (2015). 25730773
Anoctamins, a novel family of ion channels and their role in intracellular calcium signaling. Journal of Cell Science. 125, 4991-4998 (2015). 22946059
Cellular defects by deletion of ANO10 are due to deregulated local calcium signaling. Cell. Signal. 30, 41-49 (2017). 27838374
Expression of anoctamins in retinal pigment epithelium (RPE). Pflugers Arch. 468, 1921-1929 (2016). 27822608 |
| Protein Accession # |
NP_060545 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018075 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ANO10 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Human Adult Placenta
 | Host: Rabbit
Target Name: ANO10
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml |
|
| Image 2 | Human Fetal Heart
 | Host: Rabbit
Target Name: ANO10
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml |
|
| Image 3 | Human 293T
 | WB Suggested Anti-TMEM16K Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate |
|
| Image 4 | Human Brain, Cortex
 | Rabbit Anti-TMEM16K antibody
Catalog Number: ARP47389
Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cortex
Primary antibody Concentration: 1:200
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
|
|
