CLN6 Antibody - C-terminal region : FITC (ARP47372_P050-FITC)

Data Sheet
 
Product Number ARP47372_P050-FITC
Product Page www.avivasysbio.com/cln6-antibody-c-terminal-region-fitc-arp47372-p050-fitc.html
Name CLN6 Antibody - C-terminal region : FITC (ARP47372_P050-FITC)
Protein Size (# AA) 311 amino acids
Molecular Weight 36kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 54982
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ceroid-lipofuscinosis, neuronal 6, late infantile, variant
Alias Symbols nclf, CLN4A, HsT18960
Peptide Sequence Synthetic peptide located within the following region: RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference Heine,C., (2007) Mol. Membr. Biol. 24 (1), 74-87
Description of Target CLN6 is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely CLN6 involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.
Protein Interactions RNF2; BMI1; ILK; env; DERL1; VCP; UBC;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-CLN6 (ARP47372_P050-FITC) antibody
Blocking Peptide For anti-CLN6 (ARP47372_P050-FITC) antibody is Catalog # AAP47372 (Previous Catalog # AAPP28240)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CLN6
Uniprot ID Q9NWW5
Protein Name Ceroid-lipofuscinosis neuronal protein 6
Sample Type Confirmation

CLN6 is supported by BioGPS gene expression data to be expressed in HEK293T

Protein Accession # NP_060352
Purification Affinity Purified
Nucleotide Accession # NM_017882
Gene Symbol CLN6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com