Product Number |
ARP47372_P050 |
Product Page |
www.avivasysbio.com/cln6-antibody-c-terminal-region-arp47372-p050.html |
Name |
CLN6 Antibody - C-terminal region (ARP47372_P050) |
Protein Size (# AA) |
311 amino acids |
Molecular Weight |
36kDa |
NCBI Gene Id |
54982 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ceroid-lipofuscinosis, neuronal 6, late infantile, variant |
Alias Symbols |
nclf, CLN4A, HsT18960 |
Peptide Sequence |
Synthetic peptide located within the following region: RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Heine,C., (2007) Mol. Membr. Biol. 24 (1), 74-87 |
Description of Target |
CLN6 is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely CLN6 involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function. |
Protein Interactions |
RNF2; BMI1; ILK; env; DERL1; VCP; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CLN6 (ARP47372_P050) antibody |
Blocking Peptide |
For anti-CLN6 (ARP47372_P050) antibody is Catalog # AAP47372 (Previous Catalog # AAPP28240) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CLN6 |
Uniprot ID |
Q9NWW5 |
Protein Name |
Ceroid-lipofuscinosis neuronal protein 6 |
Sample Type Confirmation |
CLN6 is supported by BioGPS gene expression data to be expressed in HEK293T |
Protein Accession # |
NP_060352 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_017882 |
Tested Species Reactivity |
Human |
Gene Symbol |
CLN6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86% |
Image 1 | Human 293T
| WB Suggested Anti-CLN6 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: 293T cell lysateCLN6 is supported by BioGPS gene expression data to be expressed in HEK293T |
|
Image 2 | Human Pineal Tissue
| Rabbit Anti-CLN6 Antibody Catalog Number: ARP47372_P050 Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in cell bodies of pinealocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
|
|
Image 3 | MCF7, Human stomach
| Host: Rabbit Target: CLN6 Positive control (+): MCF7 (N10) Negative control (-): Human stomach (ST) Antibody concentration: 1ug/ml |
|