| Product Number |
ARP47371_P050 |
| Product Page |
www.avivasysbio.com/cln6-antibody-middle-region-arp47371-p050.html |
| Name |
CLN6 Antibody - middle region (ARP47371_P050) |
| Protein Size (# AA) |
311 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
54982 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ceroid-lipofuscinosis, neuronal 6, late infantile, variant |
| Alias Symbols |
nclf, CLN4A, HsT18960 |
| Peptide Sequence |
Synthetic peptide located within the following region: LPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Heine,C., (2007) Mol. Membr. Biol. 24 (1), 74-87 |
| Description of Target |
CLN6 is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely CLN6 involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function. |
| Protein Interactions |
RNF2; BMI1; ILK; env; DERL1; VCP; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CLN6 (ARP47371_P050) antibody |
| Blocking Peptide |
For anti-CLN6 (ARP47371_P050) antibody is Catalog # AAP47371 (Previous Catalog # AAPP28239) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CLN6 |
| Uniprot ID |
Q9NWW5 |
| Protein Name |
Ceroid-lipofuscinosis neuronal protein 6 |
| Protein Accession # |
NP_060352 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_017882 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CLN6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%; Zebrafish: 93% |
| Image 1 | Human Lung
 | WB Suggested Anti-CLN6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Lung |
|
|
