RHBDL2 Antibody - N-terminal region (ARP47357_P050)

• Product Number: ARP47357_P050
• Name: RHBDL2 Antibody - N-terminal region (ARP47357_P050)
• Protein Size (# AA): 303 amino acids
• Molecular Weight: 34 kDa
• NCBI Gene Id: 54933
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Rhomboid, veinlet-like 2 (Drosophila)
• Alias Symbols: RRP2
• Peptide Sequence: Synthetic peptide located within the following region: KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321
• Description of Target: RHBDL2 is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. RHBDL2 is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3.The protein encoded by this gene is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. The encoded protein is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3.
• Protein Interactions: EFNB3; EFNB2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RHBDL2 (ARP47357_P050) antibody is Catalog # AAP47357 (Previous Catalog # AAPP28225)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RHBDL2
• Uniprot ID: Q9NX52
• Protein Name: Rhomboid-related protein 2
• Protein Accession #: NP_060291
• Purification: Affinity Purified
• Nucleotide Accession #: NM_017821
• Tested Species Reactivity: Human
• Gene Symbol: RHBDL2
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 86%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 86%; Rat: 85%
• Image 1:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.