| Product Number |
ARP47356_P050 |
| Product Page |
www.avivasysbio.com/rhbdl2-antibody-n-terminal-region-arp47356-p050.html |
| Name |
RHBDL2 Antibody - N-terminal region (ARP47356_P050) |
| Protein Size (# AA) |
370 amino acids |
| Molecular Weight |
40kDa |
| NCBI Gene Id |
54933 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
rhomboid, veinlet-like 2 (Drosophila) |
| Alias Symbols |
RRP2 |
| Peptide Sequence |
Synthetic peptide located within the following region: ELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
RHBDL2 is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. RHBDL2 is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3. |
| Protein Interactions |
EFNB3; EFNB2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RHBDL2 (ARP47356_P050) antibody |
| Blocking Peptide |
For anti-RHBDL2 (ARP47356_P050) antibody is Catalog # AAP47356 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RHBDL2 |
| Uniprot ID |
B3KUN4 |
| Protein Name |
Rhomboid-related protein 2, N-terminal fragment Ensembl ENSP00000439227 |
| Publications |
Cheng, T.-L. et al. Functions of rhomboid family protease RHBDL2 and thrombomodulin in wound healing. J. Invest. Dermatol. 131, 2486-94 (2011). 21833011 |
| Protein Accession # |
NP_060291 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_017821 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RHBDL2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human 293T
 | Host: Rabbit
Target Name: RHBDL2
Sample Type: 293T Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
