| Product Number |
ARP47292_P050 |
| Product Page |
www.avivasysbio.com/dll3-antibody-n-terminal-region-arp47292-p050.html |
| Name |
DLL3 Antibody - N-terminal region (ARP47292_P050) |
| Protein Size (# AA) |
618 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
10683 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Delta-like 3 (Drosophila) |
| Description |
|
| Alias Symbols |
SCDO1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Maisenbacher,M.K., (2005) Hum. Genet. 116 (5), 416-419 |
| Description of Target |
DLL3 is a member of the delta protein ligand family. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations in this gene cause autosomal recessive spondylocostal dysostosis 1. Two transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes a member of the delta protein ligand family. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations in this gene cause autosomal recessive spondylocostal dysostosis 1. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DLL3 (ARP47292_P050) antibody |
| Blocking Peptide |
For anti-DLL3 (ARP47292_P050) antibody is Catalog # AAP47292 (Previous Catalog # AAPP28145) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DLL3 |
| Uniprot ID |
Q9NYJ7 |
| Protein Name |
Delta-like protein 3 |
| Publications |
Expression of delta-like 3 is downregulated by aberrant DNA methylation and histone modification in hepatocellular carcinoma. Oncol Rep. 39, 2209-2216 (2018). 29512761 |
| Protein Accession # |
NP_058637 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016941 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DLL3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 85%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 93% |
| Image 1 | Human HepG2
 | WB Suggested Anti-DLL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
