| Product Number |
ARP47289_P050 |
| Product Page |
www.avivasysbio.com/4930572j05rik-antibody-c-terminal-region-arp47289-p050.html |
| Name |
Them6 Antibody - C-terminal region (ARP47289_P050) |
| Protein Size (# AA) |
207 amino acids |
| Molecular Weight |
24kDa |
| NCBI Gene Id |
223626 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
RIKEN cDNA 4930572J05 gene |
| Alias Symbols |
4930572J05Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: RRSLRLFEPFEVHTRLQGWDDRAFYLEARFVSLRDGFVCALLRFRQHVLG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
THEM6; SPRR2G; SPRR2E; SPRR2D; SPRR2B; PRKDC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Them6 (ARP47289_P050) antibody |
| Blocking Peptide |
For anti-Them6 (ARP47289_P050) antibody is Catalog # AAP47289 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse 4930572J05Rik |
| Uniprot ID |
Q80ZW2 |
| Protein Name |
Protein THEM6
|
| Protein Accession # |
NP_941009 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_198607 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Them6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Mouse Stomach
 | WB Suggested Anti-4930572J05Rik Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Stomach |
|
|
