Product Number |
ARP47289_P050 |
Product Page |
www.avivasysbio.com/4930572j05rik-antibody-c-terminal-region-arp47289-p050.html |
Name |
Them6 Antibody - C-terminal region (ARP47289_P050) |
Protein Size (# AA) |
207 amino acids |
Molecular Weight |
24kDa |
NCBI Gene Id |
223626 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
RIKEN cDNA 4930572J05 gene |
Alias Symbols |
4930572J05Rik |
Peptide Sequence |
Synthetic peptide located within the following region: RRSLRLFEPFEVHTRLQGWDDRAFYLEARFVSLRDGFVCALLRFRQHVLG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Protein Interactions |
THEM6; SPRR2G; SPRR2E; SPRR2D; SPRR2B; PRKDC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Them6 (ARP47289_P050) antibody |
Blocking Peptide |
For anti-Them6 (ARP47289_P050) antibody is Catalog # AAP47289 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse 4930572J05Rik |
Uniprot ID |
Q80ZW2 |
Protein Name |
Protein THEM6
|
Protein Accession # |
NP_941009 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_198607 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Them6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Rat: 100% |
Image 1 | Mouse Stomach
| WB Suggested Anti-4930572J05Rik Antibody Titration: 1.0 ug/ml Positive Control: Mouse Stomach |
|
|