Product Number |
ARP47180_P050-Biotin |
Product Page |
www.avivasysbio.com/coq2-antibody-middle-region-biotin-arp47180-p050-biotin.html |
Name |
COQ2 Antibody - middle region : Biotin (ARP47180_P050-Biotin) |
Protein Size (# AA) |
384 amino acids |
Molecular Weight |
42kDa |
Conjugation |
Biotin |
NCBI Gene Id |
27235 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Coenzyme Q2 homolog, prenyltransferase (yeast) |
Alias Symbols |
MSA1, CL640, COQ10D1, PHB:PPT |
Peptide Sequence |
Synthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
Brown,M.A., (2007) J. Am. Soc. Nephrol. 18 (10), 2773-2780 |
Description of Target |
COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.CoQ (ubiquinone) serves as a redox carrier in the mitochondrial respiratory chain and is a lipid-soluble antioxidant. COQ2, or parahydroxybenzoate-polyprenyltransferase (EC 2.5.1.39), catalyzes one of the final reactions in the biosynthesis of CoQ, the prenylation of parahydroxybenzoate with an all-trans polyprenyl group (Forsgren et al., 2004 [PubMed 15153069]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-90 BC020728.1 1-90 91-96 BG699931.1 80-85 97-789 BC020728.1 97-789 790-792 BQ363759.1 169-171 793-1535 BC020728.1 793-1535 1536-1554 BC008804.2 1496-1514 |
Protein Interactions |
UBC; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-COQ2 (ARP47180_P050-Biotin) antibody |
Blocking Peptide |
For anti-COQ2 (ARP47180_P050-Biotin) antibody is Catalog # AAP47180 (Previous Catalog # AAPP27952) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human COQ2 |
Uniprot ID |
Q96H96 |
Protein Name |
4-hydroxybenzoate polyprenyltransferase, mitochondrial |
Sample Type Confirmation |
COQ2 is supported by BioGPS gene expression data to be expressed in DU145 |
Protein Accession # |
NP_056512 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_015697 |
Gene Symbol |
COQ2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Goat, Horse, Pig, Rabbit, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Goat: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86%; Yeast: 91%; Zebrafish: 86% |
Image 1 | |
|