COQ2 Antibody - middle region : Biotin (ARP47180_P050-Biotin)

Data Sheet
 
Product Number ARP47180_P050-Biotin
Product Page www.avivasysbio.com/coq2-antibody-middle-region-biotin-arp47180-p050-biotin.html
Name COQ2 Antibody - middle region : Biotin (ARP47180_P050-Biotin)
Protein Size (# AA) 384 amino acids
Molecular Weight 42kDa
Conjugation Biotin
NCBI Gene Id 27235
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Coenzyme Q2 homolog, prenyltransferase (yeast)
Alias Symbols MSA1, CL640, COQ10D1, PHB:PPT
Peptide Sequence Synthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference Brown,M.A., (2007) J. Am. Soc. Nephrol. 18 (10), 2773-2780
Description of Target COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.CoQ (ubiquinone) serves as a redox carrier in the mitochondrial respiratory chain and is a lipid-soluble antioxidant. COQ2, or parahydroxybenzoate-polyprenyltransferase (EC 2.5.1.39), catalyzes one of the final reactions in the biosynthesis of CoQ, the prenylation of parahydroxybenzoate with an all-trans polyprenyl group (Forsgren et al., 2004 [PubMed 15153069]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-90 BC020728.1 1-90 91-96 BG699931.1 80-85 97-789 BC020728.1 97-789 790-792 BQ363759.1 169-171 793-1535 BC020728.1 793-1535 1536-1554 BC008804.2 1496-1514
Protein Interactions UBC;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-COQ2 (ARP47180_P050-Biotin) antibody
Blocking Peptide For anti-COQ2 (ARP47180_P050-Biotin) antibody is Catalog # AAP47180 (Previous Catalog # AAPP27952)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human COQ2
Uniprot ID Q96H96
Protein Name 4-hydroxybenzoate polyprenyltransferase, mitochondrial
Sample Type Confirmation

COQ2 is supported by BioGPS gene expression data to be expressed in DU145

Protein Accession # NP_056512
Purification Affinity Purified
Nucleotide Accession # NM_015697
Gene Symbol COQ2
Predicted Species Reactivity Human, Mouse, Rat, Dog, Goat, Horse, Pig, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 93%; Goat: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86%; Yeast: 91%; Zebrafish: 86%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com