COQ2 Antibody - middle region (ARP47180_P050)

• Product Number: ARP47180_P050
• Name: COQ2 Antibody - middle region (ARP47180_P050)
• Protein Size (# AA): 384 amino acids
• Molecular Weight: 42kDa
• NCBI Gene Id: 27235
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Coenzyme Q2 homolog, prenyltransferase (yeast)
• Alias Symbols: MSA1, CL640, COQ10D1, PHB:PPT
• Peptide Sequence: Synthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Brown,M.A., (2007) J. Am. Soc. Nephrol. 18 (10), 2773-2780
• Description of Target: COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.CoQ (ubiquinone) serves as a redox carrier in the mitochondrial respiratory chain and is a lipid-soluble antioxidant. COQ2, or parahydroxybenzoate-polyprenyltransferase (EC 2.5.1.39), catalyzes one of the final reactions in the biosynthesis of CoQ, the prenylation of parahydroxybenzoate with an all-trans polyprenyl group (Forsgren et al., 2004 [PubMed 15153069]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-90 BC020728.1 1-90 91-96 BG699931.1 80-85 97-789 BC020728.1 97-789 790-792 BQ363759.1 169-171 793-1535 BC020728.1 793-1535 1536-1554 BC008804.2 1496-1514
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-COQ2 (ARP47180_P050) antibody is Catalog # AAP47180 (Previous Catalog # AAPP27952)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human COQ2
• Uniprot ID: Q96H96
• Protein Name: 4-hydroxybenzoate polyprenyltransferase, mitochondrial
• Publications:

  New animal models reveal that coenzyme Q2 (Coq2) and placenta-specific 8 (Plac8) are candidate genes for the onset of type 2 diabetes associated with obesity in rats. Mamm. Genome. 26, 619-29 (2015). 26296322

• Sample Type Confirmation:

  COQ2 is supported by BioGPS gene expression data to be expressed in DU145

• Protein Accession #: NP_056512
• Purification: Affinity Purified
• Nucleotide Accession #: NM_015697
• Tested Species Reactivity: Human
• Gene Symbol: COQ2
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Goat, Horse, Pig, Rabbit, Yeast, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 93%; Goat: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86%; Yeast: 91%; Zebrafish: 86%
• Image 1: MCF7, HepG2
  
  Host: Rabbit
  Target: COQ2
  Positive control (+): MCF7 (N10)
  Negative control (-): HepG2 (HG)
  Antibody concentration: 1ug/ml
• Image 2: Human MCF7
  
  Host: Rabbit
  Target Name: COQ2
  Sample Tissue: Human MCF7
  Antibody Dilution: 1.0ug/ml