DKFZP564J0863 Antibody - middle region : HRP (ARP47163_P050-HRP)

Data Sheet
 
Product Number ARP47163_P050-HRP
Product Page www.avivasysbio.com/dkfzp564j0863-antibody-middle-region-hrp-arp47163-p050-hrp.html
Name DKFZP564J0863 Antibody - middle region : HRP (ARP47163_P050-HRP)
Protein Size (# AA) 541 amino acids
Molecular Weight 60kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 25923
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Atlastin GTPase 3
Alias Symbols HSN1F
Peptide Sequence Synthetic peptide located within the following region: DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reference Dias (2000) Proc. Natl. Acad. Sci. U.S.A. 97 (7), 3491-3496
Description of Target DKFZP564J0863(ATL3, atlastin GTPase 3) belongs to the GBP family.In the family of human GTPases, atlastin-2 and -3 are closely related to atlastin-1.
Protein Interactions UBC; SUMO1; NEDD8; RNF2; env; APP;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-ATL3 (ARP47163_P050-HRP) antibody
Blocking Peptide For anti-ATL3 (ARP47163_P050-HRP) antibody is Catalog # AAP47163 (Previous Catalog # AAPP27936)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DKFZP564J0863
Uniprot ID Q6DD88
Protein Name Atlastin-3
Publications

Polisetty, R. V. et al. LC-MS/MS Analysis of Differentially Expressed Glioblastoma Membrane Proteome Reveals Altered Calcium Signaling and Other Protein Groups of Regulatory Functions. Mol. Cell. Proteomics 11, M111.013565-M111.013565 (2012). WB, Human, Mouse, Rat, Guinea pig, Bovine, Dog, Horse, Rabbit 22219345

Protein Accession # NP_056274
Purification Affinity Purified
Nucleotide Accession # NM_015459
Gene Symbol ATL3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com