Product Number |
ARP47163_P050-HRP |
Product Page |
www.avivasysbio.com/dkfzp564j0863-antibody-middle-region-hrp-arp47163-p050-hrp.html |
Name |
DKFZP564J0863 Antibody - middle region : HRP (ARP47163_P050-HRP) |
Protein Size (# AA) |
541 amino acids |
Molecular Weight |
60kDa |
Conjugation |
HRP: Horseradish Peroxidase |
NCBI Gene Id |
25923 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Atlastin GTPase 3 |
Alias Symbols |
HSN1F |
Peptide Sequence |
Synthetic peptide located within the following region: DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA |
Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Reference |
Dias (2000) Proc. Natl. Acad. Sci. U.S.A. 97 (7), 3491-3496 |
Description of Target |
DKFZP564J0863(ATL3, atlastin GTPase 3) belongs to the GBP family.In the family of human GTPases, atlastin-2 and -3 are closely related to atlastin-1. |
Protein Interactions |
UBC; SUMO1; NEDD8; RNF2; env; APP; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-ATL3 (ARP47163_P050-HRP) antibody |
Blocking Peptide |
For anti-ATL3 (ARP47163_P050-HRP) antibody is Catalog # AAP47163 (Previous Catalog # AAPP27936) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DKFZP564J0863 |
Uniprot ID |
Q6DD88 |
Protein Name |
Atlastin-3 |
Publications |
Polisetty, R. V. et al. LC-MS/MS Analysis of Differentially Expressed Glioblastoma Membrane Proteome Reveals Altered Calcium Signaling and Other Protein Groups of Regulatory Functions. Mol. Cell. Proteomics 11, M111.013565-M111.013565 (2012). WB, Human, Mouse, Rat, Guinea pig, Bovine, Dog, Horse, Rabbit 22219345 |
Protein Accession # |
NP_056274 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_015459 |
Gene Symbol |
ATL3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | |
|