DKFZP564J0863 Antibody - middle region (ARP47163_P050)

Data Sheet
 
Product Number ARP47163_P050
Product Page www.avivasysbio.com/dkfzp564j0863-antibody-middle-region-arp47163-p050.html
Name DKFZP564J0863 Antibody - middle region (ARP47163_P050)
Protein Size (# AA) 541 amino acids
Molecular Weight 60kDa
NCBI Gene Id 25923
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Atlastin GTPase 3
Alias Symbols HSN1F
Peptide Sequence Synthetic peptide located within the following region: DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Dias (2000) Proc. Natl. Acad. Sci. U.S.A. 97 (7), 3491-3496
Description of Target DKFZP564J0863(ATL3, atlastin GTPase 3) belongs to the GBP family.In the family of human GTPases, atlastin-2 and -3 are closely related to atlastin-1.
Protein Interactions UBC; SUMO1; NEDD8; RNF2; env; APP;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ATL3 (ARP47163_P050) antibody
Blocking Peptide For anti-ATL3 (ARP47163_P050) antibody is Catalog # AAP47163 (Previous Catalog # AAPP27936)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DKFZP564J0863
Uniprot ID Q6DD88
Protein Name Atlastin-3
Publications

Polisetty, R. V. et al. LC-MS/MS Analysis of Differentially Expressed Glioblastoma Membrane Proteome Reveals Altered Calcium Signaling and Other Protein Groups of Regulatory Functions. Mol. Cell. Proteomics 11, M111.013565-M111.013565 (2012). 22219345

Protein Accession # NP_056274
Purification Affinity Purified
Nucleotide Accession # NM_015459
Tested Species Reactivity Human
Gene Symbol ATL3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human HCT15
WB Suggested Anti-DKFZP564J0863 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: HCT15 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com