Product Number |
ARP47163_P050 |
Product Page |
www.avivasysbio.com/dkfzp564j0863-antibody-middle-region-arp47163-p050.html |
Name |
DKFZP564J0863 Antibody - middle region (ARP47163_P050) |
Protein Size (# AA) |
541 amino acids |
Molecular Weight |
60kDa |
NCBI Gene Id |
25923 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Atlastin GTPase 3 |
Alias Symbols |
HSN1F |
Peptide Sequence |
Synthetic peptide located within the following region: DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Dias (2000) Proc. Natl. Acad. Sci. U.S.A. 97 (7), 3491-3496 |
Description of Target |
DKFZP564J0863(ATL3, atlastin GTPase 3) belongs to the GBP family.In the family of human GTPases, atlastin-2 and -3 are closely related to atlastin-1. |
Protein Interactions |
UBC; SUMO1; NEDD8; RNF2; env; APP; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ATL3 (ARP47163_P050) antibody |
Blocking Peptide |
For anti-ATL3 (ARP47163_P050) antibody is Catalog # AAP47163 (Previous Catalog # AAPP27936) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DKFZP564J0863 |
Uniprot ID |
Q6DD88 |
Protein Name |
Atlastin-3 |
Publications |
Polisetty, R. V. et al. LC-MS/MS Analysis of Differentially Expressed Glioblastoma Membrane Proteome Reveals Altered Calcium Signaling and Other Protein Groups of Regulatory Functions. Mol. Cell. Proteomics 11, M111.013565-M111.013565 (2012). 22219345 |
Protein Accession # |
NP_056274 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_015459 |
Tested Species Reactivity |
Human |
Gene Symbol |
ATL3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human HCT15
| WB Suggested Anti-DKFZP564J0863 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:2500 Positive Control: HCT15 cell lysate |
|
|