| Product Number |
ARP47074_P050 |
| Product Page |
www.avivasysbio.com/4732418c07rik-antibody-c-terminal-region-arp47074-p050.html |
| Name |
Efcab14 Antibody - C-terminal region (ARP47074_P050) |
| Protein Size (# AA) |
529 amino acids |
| Molecular Weight |
59kDa |
| NCBI Gene Id |
230648 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
RIKEN cDNA 4732418C07 gene |
| Alias Symbols |
4732418C07Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: ISALTNKPESNRPPETTDEEQVQNFTSDPSALPEFSQLLRNQIETQVKPL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Efcab14 (ARP47074_P050) antibody |
| Blocking Peptide |
For anti-Efcab14 (ARP47074_P050) antibody is Catalog # AAP47074 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of 4732418C07Rik |
| Uniprot ID |
Q6PCQ6 |
| Protein Name |
EF-hand calcium-binding domain-containing protein 14
|
| Protein Accession # |
NP_766286 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_172698 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Efcab14 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | Mouse Liver
 | WB Suggested Anti-4732418C07Rik Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Liver |
|
|
