EDEM1 Antibody - N-terminal region : HRP (ARP47054_P050-HRP)

Data Sheet
 
Product Number ARP47054_P050-HRP
Product Page www.avivasysbio.com/edem1-antibody-n-terminal-region-hrp-arp47054-p050-hrp.html
Name EDEM1 Antibody - N-terminal region : HRP (ARP47054_P050-HRP)
Protein Size (# AA) 657 amino acids
Molecular Weight 74kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 9695
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name ER degradation enhancer, mannosidase alpha-like 1
Alias Symbols EDEM
Peptide Sequence Synthetic peptide located within the following region: MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reference Zuber,C., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (11), 4407-4412
Description of Target EDEM1 belongs to the glycosyl hydrolase 47 family. It extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, from the calnexin cycle. It is directly involved in endoplasmic reticulum-associated degradation (ERAD) and targets misfolded glycoproteins for degradation in an N-glycan-dependent manner.
Protein Interactions HLA-B; SQSTM1; UBC; MMS19; SSR1; ASGR1; DERL1; DNAJC10; DERL2; SEC61B; SEL1L; RHO; CANX; RCOM_2159910; ASGR2; ELAVL1; BZW1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-EDEM1 (ARP47054_P050-HRP) antibody
Blocking Peptide For anti-EDEM1 (ARP47054_P050-HRP) antibody is Catalog # AAP47054 (Previous Catalog # AAPP27852)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human EDEM1
Uniprot ID Q92611
Protein Name ER degradation-enhancing alpha-mannosidase-like 1
Sample Type Confirmation

EDEM1 is supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_055489
Purification Affinity Purified
Nucleotide Accession # NM_014674
Gene Symbol EDEM1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com