EDEM1 Antibody - N-terminal region (ARP47054_P050)

Data Sheet
 
Product Number ARP47054_P050
Product Page www.avivasysbio.com/edem1-antibody-n-terminal-region-arp47054-p050.html
Name EDEM1 Antibody - N-terminal region (ARP47054_P050)
Protein Size (# AA) 657 amino acids
Molecular Weight 74kDa
NCBI Gene Id 9695
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name ER degradation enhancer, mannosidase alpha-like 1
Description
Alias Symbols EDEM
Peptide Sequence Synthetic peptide located within the following region: MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zuber,C., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (11), 4407-4412
Description of Target EDEM1 belongs to the glycosyl hydrolase 47 family. It extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, from the calnexin cycle. It is directly involved in endoplasmic reticulum-associated degradation (ERAD) and targets misfolded glycoproteins for degradation in an N-glycan-dependent manner.
Protein Interactions HLA-B; SQSTM1; UBC; MMS19; SSR1; ASGR1; DERL1; DNAJC10; DERL2; SEC61B; SEL1L; RHO; CANX; RCOM_2159910; ASGR2; ELAVL1; BZW1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-EDEM1 (ARP47054_P050) antibody
Blocking Peptide For anti-EDEM1 (ARP47054_P050) antibody is Catalog # AAP47054 (Previous Catalog # AAPP27852)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human EDEM1
Uniprot ID Q92611
Protein Name ER degradation-enhancing alpha-mannosidase-like 1
Sample Type Confirmation

EDEM1 is supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_055489
Purification Affinity Purified
Nucleotide Accession # NM_014674
Tested Species Reactivity Human
Gene Symbol EDEM1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%
Image 1
Human 721_B
WB Suggested Anti-EDEM1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysateEDEM1 is supported by BioGPS gene expression data to be expressed in 721_B
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com