| Product Number |
ARP46963_P050 |
| Product Page |
www.avivasysbio.com/astn2-antibody-n-terminal-region-arp46963-p050.html |
| Name |
ASTN2 Antibody - N-terminal region (ARP46963_P050) |
| Protein Size (# AA) |
1288 amino acids |
| Molecular Weight |
142kDa |
| NCBI Gene Id |
23245 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Astrotactin 2 |
| Alias Symbols |
bA67K19.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADISLVHWRQQWLENG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ASTN2 may play an important role in neuronal functioning. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ASTN2 (ARP46963_P050) antibody |
| Other Applications Image 1 Data |
Immunocytochemistry --
Sample Type: Mouse cerebellar granule cells
Dilution: 1:100 |
| Other Applications Image 2 Data |
Immunocytochemistry --
Sample Type: Human Fibroblasts
Dilution: 1:100 |
| Blocking Peptide |
For anti-ASTN2 (ARP46963_P050) antibody is Catalog # AAP46963 (Previous Catalog # AAPP27761) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ASTN2 |
| Uniprot ID |
O75129-2 |
| Protein Name |
Astrotactin-2 |
| Protein Accession # |
NP_054729 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014010 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ASTN2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Guinea Pig |
| Application |
WB, ICC |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Human Liver
 | WB Suggested Anti-ASTN2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver |
|
|
