ASTN2 antibody - N-terminal region (ARP46963_P050)
Data Sheet
 
Product Number ARP46963_P050
Product Page www.avivasysbio.com/astn2-antibody-n-terminal-region-arp46963-p050.html
Product Name ASTN2 antibody - N-terminal region (ARP46963_P050)
Size 100 ul
Gene Symbol ASTN2
Alias Symbols KIAA0634, bA67K19.1
Protein Size (# AA) 1288 amino acids
Molecular Weight 142kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 23245
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Astrotactin 2
Description This is a rabbit polyclonal antibody against ASTN2. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: LLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADISLVHWRQQWLENG
Description of Target ASTN2 may play an important role in neuronal functioning.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ASTN2 (ARP46963_P050) antibody is Catalog # AAP46963 (Previous Catalog # AAPP27761)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ASTN2
Complete computational species homology data Anti-ASTN2 (ARP46963_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ASTN2.
Swissprot Id O75129-2
Protein Name Astrotactin-2
Protein Accession # NP_054729
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ASTN2.
Nucleotide Accession # NM_014010
Replacement Item This antibody may replace item sc-54863 from Santa Cruz Biotechnology.
Conjugation Options

ARP46963_P050-FITC Conjugated

ARP46963_P050-HRP Conjugated

ARP46963_P050-Biotin Conjugated

CB Replacement sc-54863
Species Reactivity Guinea Pig, Human, Mouse, Rat
Application WB, ICC
Predicted Homology Based on Immunogen Sequence Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
Human Liver
WB Suggested Anti-ASTN2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com