BACE1 Antibody - N-terminal region (ARP46851_P050)

• Product Number: ARP46851_P050
• Name: BACE1 Antibody - N-terminal region (ARP46851_P050)
• Protein Size (# AA): 501 amino acids
• Molecular Weight: 51 kDa
• NCBI Gene Id: 23621
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Beta-site APP-cleaving enzyme 1
• Alias Symbols: ASP2, BACE, HSPC104
• Peptide Sequence: Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Shimizu,H., (2008) Mol. Cell. Biol. 28 (11), 3663-3671
• Description of Target: Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein encoded by this gene. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi. Four transcript variants encoding different isoforms have been described for this gene.
• Protein Interactions: COPS5; BRI3; RANBP9; APP; PCSK9; GGA1; GGA3; GGA2; UBC; FBXO2; CMPK1; ITM2C; KHSRP; PLSCR1; NCSTN; PDIA3; CSNK1D; SELPLG; ATP1B1; PSAP; FURIN; MMP2; LRP1; PSEN1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: SPR Affinity Characterization
  
• Additional Information: IHC Information: Testis
  IHC Information: Adrenal
• Blocking Peptide: Catalog # AAP46851 (Previous Catalog # AAPP27647)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BACE1
• Uniprot ID: P56817
• Protein Name: Beta-secretase 1
• Protein Accession #: NP_036236
• Purification: Affinity Purified
• Nucleotide Accession #: NM_012104
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: BACE1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB, IF
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
• Image 1: Mouse astrocytes
  
  Immunofluorescent BACE1 detection in mouse astrocytes (red fluorescence). Nuclei were stained with DAPI (blue fluorescence).
  Working Dilution: 2-10 ug/ml
• Image 2: Human Adrenal
  
  Anti-BACE1 antibody IHC of human adrenal. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody ARP46851_P050 concentration 5 ug/ml.
• Image 3: Human Testis
  
  Anti-BACE1 antibody IHC of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody ARP46851_P050 concentration 5 ug/ml.
• Image 4: Human Fetal Liver
  
  Host: Rabbit
  Target Name: BACE1
  Sample Type: Human Fetal Liver
  Lane A: Primary Antibody
  Lane B: Primary Antibody + Blocking Peptide
  Primary Antibody Concentration: 1ug/ml
  Peptide Concentration: 5ug/ml
  Lysate Quantity: 25ug/lane/lane
  Gel Concentration: 0.12
• Image 5:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.