Product Number |
ARP46815_P050 |
Product Page |
www.avivasysbio.com/rer1-antibody-middle-region-arp46815-p050.html |
Name |
RER1 Antibody - middle region (ARP46815_P050) |
Protein Size (# AA) |
196 amino acids |
Molecular Weight |
23kDa |
NCBI Gene Id |
11079 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae) |
Alias Symbols |
RP4-740C4.2 |
Peptide Sequence |
Synthetic peptide located within the following region: GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kaether,C., (2007) EMBO Rep. 8 (8), 743-748 |
Description of Target |
RER1 is involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment. |
Protein Interactions |
SYVN1; UBC; RNF2; env; UBL4A; SH3GL3; HAP1; IMMT; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RER1 (ARP46815_P050) antibody |
Blocking Peptide |
For anti-RER1 (ARP46815_P050) antibody is Catalog # AAP46815 (Previous Catalog # AAPP27613) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RER1 |
Uniprot ID |
O15258 |
Protein Name |
Protein RER1 |
Protein Accession # |
NP_008964 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_007033 |
Tested Species Reactivity |
Human |
Gene Symbol |
RER1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
Image 1 | Human Adult Liver
| Rabbit Anti-RER1 Antibody
Catalog Number: ARP46815_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm in hepatocytes, strong signal, very wide tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
Image 2 | Human 293T
| WB Suggested Anti-RER1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: 293T cell lysate |
|