| Product Number |
ARP46788_P050 |
| Product Page |
www.avivasysbio.com/lman2-antibody-n-terminal-region-arp46788-p050.html |
| Name |
LMAN2 Antibody - N-terminal region (ARP46788_P050) |
| Protein Size (# AA) |
356 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
10960 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Lectin, mannose-binding 2 |
| Alias Symbols |
GP36B, VIP36, C5orf8 |
| Peptide Sequence |
Synthetic peptide located within the following region: SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Breuza,L., (2004) J. Biol. Chem. 279 (45), 47242-47253 |
| Description of Target |
LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans. |
| Protein Interactions |
UBC; RPA1; RPA3; RPA2; ATP4A; env; FRAT1; UBL4A; SUPT5H; MAPK9; FLOT1; ATP13A2; ISG15; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LMAN2 (ARP46788_P050) antibody |
| Additional Information |
IHC Information: Jurkat cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-LMAN2 (ARP46788_P050) antibody is Catalog # AAP46788 (Previous Catalog # AAPP27586) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LMAN2 |
| Uniprot ID |
Q12907 |
| Protein Name |
Vesicular integral-membrane protein VIP36 |
| Protein Accession # |
NP_006807 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006816 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LMAN2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-LMAN2 Antibody Titration: 1 ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human Lung Tissue
 | LMAN2 antibody - N-terminal region (ARP46788_P050)
Catalog Number: ARP46788_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
Observed Staining: Cytoplasm of pneumocytes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
| Image 3 | Human kidney
 | Human kidney |
|
