Product Number |
ARP46769_P050 |
Product Page |
www.avivasysbio.com/btnl3-antibody-n-terminal-region-arp46769-p050.html |
Name |
BTNL3 Antibody - N-terminal region (ARP46769_P050) |
Protein Size (# AA) |
466 amino acids |
Molecular Weight |
52 kDa |
NCBI Gene Id |
10917 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Butyrophilin-like 3 |
Description |
|
Alias Symbols |
BTNLR, BTN9.1 |
Peptide Sequence |
Synthetic peptide located within the following region: EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270 |
Description of Target |
The specific function of BTNL3 is not yet known. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-BTNL3 (ARP46769_P050) antibody |
Blocking Peptide |
For anti-BTNL3 (ARP46769_P050) antibody is Catalog # AAP46769 (Previous Catalog # AAPP27568) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human BTNL3 |
Uniprot ID |
Q6UXE8 |
Protein Name |
Butyrophilin-like protein 3 |
Publications |
Butyrophilin-like 3 Directly Binds a Human Vγ4+ T Cell Receptor Using a Modality Distinct from Clonally-Restricted Antigen. Immunity. 51, 813-825.e4 (2019). 31628053 |
Protein Accession # |
NP_932079 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_197975 |
Tested Species Reactivity |
Human |
Gene Symbol |
BTNL3 |
Predicted Species Reactivity |
Human, Cow, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Horse: 77%; Human: 100%; Pig: 77% |
Image 1 | Human Lung
| WB Suggested Anti-BTNL3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Lung |
| Image 2 | Human Fetal Heart
| Host: Rabbit Target Name: GNAS Sample Type: Human Fetal Heart Antibody Dilution: 1.0ug/ml |
| Image 3 | Human Fetal Muscle
| Host: Rabbit Target Name: NOP56 Sample Type: Human Fetal Muscle Antibody Dilution: 1.0ug/ml |
|
|