BTNL3 Antibody - N-terminal region (ARP46769_P050)

Data Sheet
 
Product Number ARP46769_P050
Product Page www.avivasysbio.com/btnl3-antibody-n-terminal-region-arp46769-p050.html
Name BTNL3 Antibody - N-terminal region (ARP46769_P050)
Protein Size (# AA) 466 amino acids
Molecular Weight 52 kDa
NCBI Gene Id 10917
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Butyrophilin-like 3
Description
Alias Symbols BTNLR, BTN9.1
Peptide Sequence Synthetic peptide located within the following region: EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270
Description of Target The specific function of BTNL3 is not yet known.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-BTNL3 (ARP46769_P050) antibody
Blocking Peptide For anti-BTNL3 (ARP46769_P050) antibody is Catalog # AAP46769 (Previous Catalog # AAPP27568)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human BTNL3
Uniprot ID Q6UXE8
Protein Name Butyrophilin-like protein 3
Publications

Butyrophilin-like 3 Directly Binds a Human Vγ4+ T Cell Receptor Using a Modality Distinct from Clonally-Restricted Antigen. Immunity. 51, 813-825.e4 (2019). 31628053

Protein Accession # NP_932079
Purification Affinity Purified
Nucleotide Accession # NM_197975
Tested Species Reactivity Human
Gene Symbol BTNL3
Predicted Species Reactivity Human, Cow, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 77%; Horse: 77%; Human: 100%; Pig: 77%
Image 1
Human Lung
WB Suggested Anti-BTNL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung
Image 2
Human Fetal Heart
Host: Rabbit
Target Name: GNAS
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml
Image 3
Human Fetal Muscle
Host: Rabbit
Target Name: NOP56
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com