| Product Number |
ARP46640_P050 |
| Product Page |
www.avivasysbio.com/tspan5-antibody-middle-region-arp46640-p050.html |
| Name |
TSPAN5 Antibody - middle region (ARP46640_P050) |
| Protein Size (# AA) |
268 amino acids |
| Molecular Weight |
30 kDa |
| NCBI Gene Id |
10098 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Tetraspanin 5 |
| Description |
|
| Alias Symbols |
NET4, NET-4, TM4SF9, TSPAN-5 |
| Peptide Sequence |
Synthetic peptide located within the following region: ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ |
| Product Format |
Lyophilized from 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Cools,J., J. Cell. Sci. 114 (PT 23), 4143-4151 (2001) |
| Description of Target |
TSPAN5 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. |
| Protein Interactions |
APP; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| SPR Affinity Characterization |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-TSPAN5 (ARP46640_P050) antibody |
| Additional Information |
IHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-TSPAN5 (ARP46640_P050) antibody is Catalog # AAP46640 (Previous Catalog # AAPP27443) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TSPAN5 |
| Uniprot ID |
P62079 |
| Protein Name |
Tetraspanin-5 |
| Protein Accession # |
NP_005714 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005723 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TSPAN5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human 293T Whole Cell
 | Host: Rabbit
Target Name: TSPAN5
Sample Tissue: Human 293T Whole Cell
Antibody Dilution: 1ug/ml |
|
| Image 2 | Human Jurkat
 | TSPAN5 antibody - middle region (ARP46640_P050) validated by WB using Jurkat cell lysate at 0.25ug/ml. |
|
| Image 3 | Human kidney
 | Human kidney |
|
| Image 4 |
 | Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
|
|
