| Product Number |
ARP46637_T100 |
| Product Page |
www.avivasysbio.com/ust-antibody-c-terminal-region-arp46637-t100.html |
| Name |
UST Antibody - C-terminal region (ARP46637_T100) |
| Protein Size (# AA) |
406 amino acids |
| Molecular Weight |
48kDa |
| NCBI Gene Id |
10090 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Uronyl-2-sulfotransferase |
| Alias Symbols |
2OST |
| Peptide Sequence |
Synthetic peptide located within the following region: YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ohtake,S., (2005) J. Biol. Chem. 280 (47), 39115-39123 |
| Description of Target |
UST catalyzes the transfer of sulfate to the position 2 of uronyl residues. UST has mainly activity toward iduronyl residues in dermatan sulfate, and weaker activity toward glucuronyl residues of chondroitin sulfate. It has no activity toward desulfated N-resulfated heparin. |
| Protein Interactions |
Dlg4; CUL3; ELAVL1; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-UST (ARP46637_T100) antibody |
| Additional Information |
IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-UST (ARP46637_T100) antibody is Catalog # AAP46637 (Previous Catalog # AAPP27440) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human UST |
| Uniprot ID |
Q9Y2C2 |
| Protein Name |
Uronyl 2-sulfotransferase |
| Protein Accession # |
NP_005706 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_005715 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
UST |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human kidney
 | Human kidney |
|
| Image 2 | Human HepG2
 | WB Suggested Antibody Titration: 2.5 ug/ml
Positive Control: HepG0 |
|
