Product Number |
ARP46636_T100 |
Product Page |
www.avivasysbio.com/tspan32-antibody-middle-region-arp46636-t100.html |
Name |
TSPAN32 Antibody - middle region (ARP46636_T100) |
Protein Size (# AA) |
290 amino acids |
Molecular Weight |
31kDa |
NCBI Gene Id |
10077 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
tetraspanin 32 |
Alias Symbols |
ART1, PHMX, PHEMX, TSSC6 |
Peptide Sequence |
Synthetic peptide located within the following region: YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Robb,L., (2001) Biochim. Biophys. Acta 1522 (1), 31-41 |
Description of Target |
This gene, which is a member of the tetraspanin superfamily, is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of chromosome 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian and breast cancers. This gene is located among several imprinted genes; however, this gene, as well as the tumor-suppressing subchromosomal transferable fragment 4, escapes imprinting. This gene may play a role in malignancies and diseases that involve this region, and it is also involved in hematopoietic cell function. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TSPAN32 (ARP46636_T100) antibody |
Blocking Peptide |
For anti-TSPAN32 (ARP46636_T100) antibody is Catalog # AAP46636 (Previous Catalog # AAPP27439) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TSPAN32 |
Uniprot ID |
Q96QS1-2 |
Protein Name |
tetraspanin-32 |
Protein Accession # |
NP_005696 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_005705 |
Tested Species Reactivity |
Human |
Gene Symbol |
TSPAN32 |
Predicted Species Reactivity |
Human |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-TSPAN32 Antibody Titration: 5.0ug/ml Positive Control: Jurkat cell lysate |
| Image 2 | Human Liver
| Human Liver |
|
|