TSPAN32 Antibody - middle region (ARP46636_T100)

Data Sheet
 
Product Number ARP46636_T100
Product Page www.avivasysbio.com/tspan32-antibody-middle-region-arp46636-t100.html
Name TSPAN32 Antibody - middle region (ARP46636_T100)
Protein Size (# AA) 290 amino acids
Molecular Weight 31kDa
NCBI Gene Id 10077
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name tetraspanin 32
Alias Symbols ART1, PHMX, PHEMX, TSSC6
Peptide Sequence Synthetic peptide located within the following region: YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Robb,L., (2001) Biochim. Biophys. Acta 1522 (1), 31-41
Description of Target This gene, which is a member of the tetraspanin superfamily, is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of chromosome 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian and breast cancers. This gene is located among several imprinted genes; however, this gene, as well as the tumor-suppressing subchromosomal transferable fragment 4, escapes imprinting. This gene may play a role in malignancies and diseases that involve this region, and it is also involved in hematopoietic cell function. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TSPAN32 (ARP46636_T100) antibody
Blocking Peptide For anti-TSPAN32 (ARP46636_T100) antibody is Catalog # AAP46636 (Previous Catalog # AAPP27439)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TSPAN32
Uniprot ID Q96QS1-2
Protein Name tetraspanin-32
Protein Accession # NP_005696
Purification Protein A purified
Nucleotide Accession # NM_005705
Tested Species Reactivity Human
Gene Symbol TSPAN32
Predicted Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-TSPAN32 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
Image 2
Human Liver
Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com