IFNGR2 Antibody - middle region (ARP46611_P050)

Data Sheet
 
Product Number ARP46611_P050
Product Page www.avivasysbio.com/ifngr2-antibody-middle-region-arp46611-p050.html
Name IFNGR2 Antibody - middle region (ARP46611_P050)
Protein Size (# AA) 337 amino acids
Molecular Weight 35kDa
NCBI Gene Id 3460
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Interferon gamma receptor 2 (interferon gamma transducer 1)
Alias Symbols AF-1, IFGR2, IMD28, IFNGT1
Peptide Sequence Synthetic peptide located within the following region: WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Jin,Y.H., (2008) Biochem. Biophys. Res. Commun. 368 (3), 690-695
Description of Target IFNGR2 is the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.This gene (IFNGR2) encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions RPL37A; CAMK2D; ELAVL1; DNAJA3; JAK2; IFNG; NR3C1; ANXA5; IFNGR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-IFNGR2 (ARP46611_P050) antibody
Blocking Peptide For anti-IFNGR2 (ARP46611_P050) antibody is Catalog # AAP46611 (Previous Catalog # AAPS19711)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human IFNGR2
Uniprot ID P38484
Protein Name Interferon gamma receptor 2
Publications

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828

Protein Accession # NP_005525
Purification Affinity Purified
Nucleotide Accession # NM_005534
Tested Species Reactivity Human
Gene Symbol IFNGR2
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Liver
WB Suggested Anti-IFNGR2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com