Product Number |
ARP46611_P050 |
Product Page |
www.avivasysbio.com/ifngr2-antibody-middle-region-arp46611-p050.html |
Name |
IFNGR2 Antibody - middle region (ARP46611_P050) |
Protein Size (# AA) |
337 amino acids |
Molecular Weight |
35kDa |
NCBI Gene Id |
3460 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Interferon gamma receptor 2 (interferon gamma transducer 1) |
Alias Symbols |
AF-1, IFGR2, IMD28, IFNGT1 |
Peptide Sequence |
Synthetic peptide located within the following region: WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Jin,Y.H., (2008) Biochem. Biophys. Res. Commun. 368 (3), 690-695 |
Description of Target |
IFNGR2 is the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.This gene (IFNGR2) encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
RPL37A; CAMK2D; ELAVL1; DNAJA3; JAK2; IFNG; NR3C1; ANXA5; IFNGR1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-IFNGR2 (ARP46611_P050) antibody |
Blocking Peptide |
For anti-IFNGR2 (ARP46611_P050) antibody is Catalog # AAP46611 (Previous Catalog # AAPS19711) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human IFNGR2 |
Uniprot ID |
P38484 |
Protein Name |
Interferon gamma receptor 2 |
Publications |
Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828 |
Protein Accession # |
NP_005525 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005534 |
Tested Species Reactivity |
Human |
Gene Symbol |
IFNGR2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Liver
| WB Suggested Anti-IFNGR2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Liver |
|