DCC Antibody - middle region : FITC (ARP46583_P050-FITC)

Data Sheet
 
Product Number ARP46583_P050-FITC
Product Page www.avivasysbio.com/dcc-antibody-middle-region-fitc-arp46583-p050-fitc.html
Name DCC Antibody - middle region : FITC (ARP46583_P050-FITC)
Protein Size (# AA) 1447 amino acids
Molecular Weight 158kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 1630
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Deleted in colorectal carcinoma
Alias Symbols CRC18, CRCR1, MRMV1, HGPPS2, IGDCC1, NTN1R1
Peptide Sequence Synthetic peptide located within the following region: PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target This gene encodes a netrin 1 receptor. The transmembrane protein is a member of the immunoglobulin superfamily of cell adhesion molecules, and mediates axon guidance of neuronal growth cones towards sources of netrin 1 ligand. The cytoplasmic tail interacts with the tyrosine kinases Src and focal adhesion kinase (FAK, also known as PTK2) to mediate axon attraction. The protein partially localizes to lipid rafts, and induces apoptosis in the absence of ligand. The protein functions as a tumor suppressor, and is frequently mutated or downregulated in colorectal cancer and esophageal carcinoma.
Protein Interactions UBC; ALB; BARD1; sina; UBI4; SIAH2; EIF4E3; EIF2A; EIF5A2; NTN1; RPL23; EIF2S2; EIF2B2; EIF2B4; EZR; RPS24; RPS13; RPS10; RPS6; RPS4X; RPL38; RPL28; RPL13; RPL5; PTK2; MAPK1; RPL10A; EIF3E; EIF4E; EIF2S3; EIF2B1; EIF1AX; ADORA2B; APPL1; CASP9; SIAH1; MAPK
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-DCC (ARP46583_P050-FITC) antibody
Blocking Peptide For anti-DCC (ARP46583_P050-FITC) antibody is Catalog # AAP46583 (Previous Catalog # AAPS19506)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DCC
Uniprot ID P43146
Protein Name Netrin receptor DCC
Protein Accession # NP_005206
Purification Affinity Purified
Nucleotide Accession # NM_005215
Gene Symbol DCC
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com