| Product Number |
ARP46558_T100 |
| Product Page |
www.avivasysbio.com/kcnc1-antibody-n-terminal-region-arp46558-t100.html |
| Name |
KCNC1 Antibody - N-terminal region (ARP46558_T100) |
| Protein Size (# AA) |
511 amino acids |
| Molecular Weight |
58kDa |
| NCBI Gene Id |
3746 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Potassium voltage-gated channel, Shaw-related subfamily, member 1 |
| Alias Symbols |
KV4, EPM7, NGK2, KV3.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ried,T., (1993) Genomics 15 (2), 405-411 |
| Description of Target |
KCNC1 belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. |
| Protein Interactions |
DLG1; CAMK2A; KCNG3; KCNC1; KCNV2; ANK3; KCNH1; KCNC2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KCNC1 (ARP46558_T100) antibody |
| Blocking Peptide |
For anti-KCNC1 (ARP46558_T100) antibody is Catalog # AAP46558 (Previous Catalog # AAPP27409) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNC1 |
| Uniprot ID |
P48547 |
| Protein Name |
Potassium voltage-gated channel subfamily C member 1 |
| Protein Accession # |
NP_004967 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_004976 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KCNC1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Human HepG2
 | WB Suggested Anti-KCNC1 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate |
|
|
