CPT1B Antibody - middle region (ARP46444_P050)

Data Sheet
 
Product Number ARP46444_P050
Product Page www.avivasysbio.com/cpt1b-antibody-middle-region-arp46444-p050.html
Name CPT1B Antibody - middle region (ARP46444_P050)
Gene Symbol CPT1B
Alias Symbols CPT1-M, KIAA1670, M-CPT1, CPTI, CPT1M, MCPT1, CPTI-M, MCCPT1
Protein Size (# AA) 772 amino acids
Molecular Weight 88kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 1375
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Carnitine palmitoyltransferase 1B (muscle)
Peptide Sequence Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
Description of Target The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-
Protein Interactions C2orf57;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CPT1B (ARP46444_P050) antibody
Blocking Peptide For anti-CPT1B (ARP46444_P050) antibody is Catalog # AAP46444 (Previous Catalog # AAPS18310)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CPT1B
Complete computational species homology data Anti-CPT1B (ARP46444_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CPT1B.
Swissprot Id Q92523
Protein Name Carnitine O-palmitoyltransferase 1, muscle isoform
Publications

Jiang, X; Ma, H; Li, C; Cao, Y; Wang, Y; Zhang, Y; Liu, Y; Effects of neonatal dexamethasone administration on cardiac recovery ability under ischemia-reperfusion in 24-wk-old rats. 80, 128-35 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 26991264

Li, X; Liu, Y; Ma, H; Guan, Y; Cao, Y; Tian, Y; Zhang, Y; Enhancement of Glucose Metabolism via PGC-1α Participates in the Cardioprotection of Chronic Intermittent Hypobaric Hypoxia. 7, 219 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 27375497

Wolf-Johnston, A. S. et al. Alterations in the non-neuronal acetylcholine synthesis and release machinery in esophageal epithelium. Life Sci. 91, 1065-9 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 22569297

Sample Type Confirmation

CPT1B is supported by BioGPS gene expression data to be expressed in HT1080

Protein Accession # NP_004368
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CPT1B.
Nucleotide Accession # NM_004377
Replacement Item This antibody may replace item sc-20514 from Santa Cruz Biotechnology.
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
Image 1
Human 293T
Host: Rabbit
Target Name: CPT1B
Sample Tissue: Human 293T
Antibody Dilution: 1.0ug/ml
Image 2
Mouse Spleen
Host: Rabbit
Target Name: CPT1B
Sample Tissue: Mouse Spleen
Antibody Dilution: 1ug/ml
Image 3
Mouse Spleen
Host: Mouse
Target Name: CPT1B
Sample Tissue: Mouse Spleen
Antibody Dilution: 1ug/ml
Image 4
Human Capan1
Sample Type:
1: 45ug human capan1 cell lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit HRP
Secondary Antibody Dilution:
1:5000
Color/Signal Descriptions:
ARP46444-QC16367-WB-image-02
Gene Name:
CPT1B
Submitted by:
Dr. Pankaj Kumar Singh, UNMC, Omaha, NE
Image 5
Human Capan1
rsearcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NE
Application: IHC
Species+tissue/cell type:
Species+tissue/cell type: Human Capan1 cells
Primary antibody dilution: 1:300
Secondary antibody: Anti-rabbit Alexa Fluor 488
Secondary antibody dilution:1:200
Image 6
Hela, Human liver
Host: Rabbit
Target: CPT1B
Positive control (+): Hela (HL)
Negative control (-): Human liver (LI)
Antibody concentration: 0.5ug/ml
Image 7
Human 293T Whole Cell
Host: Rabbit
Target Name: CPT1B
Sample Tissue: Human 293T Whole Cell
Antibody Dilution: 1ug/ml
Image 8
Human PANC1 Whole Cell
Host: Rabbit
Target Name: CPT1B
Sample Tissue: Human PANC1 Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com