Product Number |
ARP46444_P050 |
Product Page |
www.avivasysbio.com/cpt1b-antibody-middle-region-arp46444-p050.html |
Name |
CPT1B Antibody - middle region (ARP46444_P050) |
Protein Size (# AA) |
772 amino acids |
Molecular Weight |
88 kDa |
NCBI Gene Id |
1375 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Carnitine palmitoyltransferase 1B (muscle) |
Alias Symbols |
CPTI, CPT1M, MCPT1, CPT1-M, CPTI-M, M-CPT1, MCCPT1 |
Peptide Sequence |
Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long- |
Protein Interactions |
C2orf57; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-CPT1B (ARP46444_P050) antibody |
Blocking Peptide |
For anti-CPT1B (ARP46444_P050) antibody is Catalog # AAP46444 (Previous Catalog # AAPS18310) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CPT1B |
Uniprot ID |
Q92523 |
Protein Name |
Carnitine O-palmitoyltransferase 1, muscle isoform |
Publications |
Effects of neonatal dexamethasone administration on cardiac recovery ability under ischemia-reperfusion in 24-wk-old rats. Pediatr. Res. 80, 128-35 (2016). 26991264
Enhancement of Glucose Metabolism via PGC-1a Participates in the Cardioprotection of Chronic Intermittent Hypobaric Hypoxia. Front Physiol. 7, 219 (2016). 27375497
Wolf-Johnston, A. S. et al. Alterations in the non-neuronal acetylcholine synthesis and release machinery in esophageal epithelium. Life Sci. 91, 1065-9 (2012). 22569297 |
Sample Type Confirmation |
CPT1B is supported by BioGPS gene expression data to be expressed in HT1080 |
Protein Accession # |
NP_004368 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_004377 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
CPT1B |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92% |
Image 1 | Mouse Spleen
| Host: Rabbit Target Name: CPT1B Sample Tissue: Mouse Spleen Antibody Dilution: 1ug/ml |
|
Image 2 | Mouse Spleen
| Host: Mouse Target Name: CPT1B Sample Tissue: Mouse Spleen Antibody Dilution: 1ug/ml |
|
Image 3 | Human Capan1
| rsearcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NE Application: IHC Species+tissue/cell type: Species+tissue/cell type: Human Capan1 cells Primary antibody dilution: 1:300 Secondary antibody: Anti-rabbit Alexa Fluor 488 Secondary antibody dilution:1:200 |
|
Image 4 | Western Blot
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. |
|