CPT1B Antibody - middle region (ARP46444_P050)

Data Sheet
 
Product Number ARP46444_P050
Product Page www.avivasysbio.com/cpt1b-antibody-middle-region-arp46444-p050.html
Name CPT1B Antibody - middle region (ARP46444_P050)
Protein Size (# AA) 772 amino acids
Molecular Weight 88 kDa
NCBI Gene Id 1375
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Carnitine palmitoyltransferase 1B (muscle)
Alias Symbols CPTI, CPT1M, MCPT1, CPT1-M, CPTI-M, M-CPT1, MCCPT1
Peptide Sequence Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-
Protein Interactions C2orf57;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-CPT1B (ARP46444_P050) antibody
Blocking Peptide For anti-CPT1B (ARP46444_P050) antibody is Catalog # AAP46444 (Previous Catalog # AAPS18310)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CPT1B
Uniprot ID Q92523
Protein Name Carnitine O-palmitoyltransferase 1, muscle isoform
Publications

Effects of neonatal dexamethasone administration on cardiac recovery ability under ischemia-reperfusion in 24-wk-old rats. Pediatr. Res. 80, 128-35 (2016). 26991264

Enhancement of Glucose Metabolism via PGC-1a Participates in the Cardioprotection of Chronic Intermittent Hypobaric Hypoxia. Front Physiol. 7, 219 (2016). 27375497

Wolf-Johnston, A. S. et al. Alterations in the non-neuronal acetylcholine synthesis and release machinery in esophageal epithelium. Life Sci. 91, 1065-9 (2012). 22569297

Sample Type Confirmation

CPT1B is supported by BioGPS gene expression data to be expressed in HT1080

Protein Accession # NP_004368
Purification Affinity Purified
Nucleotide Accession # NM_004377
Tested Species Reactivity Human, Mouse
Gene Symbol CPT1B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
Image 1
Mouse Spleen
Host: Rabbit
Target Name: CPT1B
Sample Tissue: Mouse Spleen
Antibody Dilution: 1ug/ml
Image 2
Mouse Spleen
Host: Mouse
Target Name: CPT1B
Sample Tissue: Mouse Spleen
Antibody Dilution: 1ug/ml
Image 3
Human Capan1
rsearcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NE
Application: IHC
Species+tissue/cell type:
Species+tissue/cell type: Human Capan1 cells
Primary antibody dilution: 1:300
Secondary antibody: Anti-rabbit Alexa Fluor 488
Secondary antibody dilution:1:200
Image 4
Western Blot
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com