CDH7 Antibody - N-terminal region (ARP46435_P050)

• Product Number: ARP46435_P050
• Name: CDH7 Antibody - N-terminal region (ARP46435_P050)
• Protein Size (# AA): 785 amino acids
• Molecular Weight: 82kDa
• NCBI Gene Id: 1005
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cadherin 7, type 2
• Alias Symbols: CDH7L1
• Peptide Sequence: Synthetic peptide located within the following region: PKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPTYGNSARVVYSILQGQP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Moore,R., (2004) Oncogene 23 (40), 6726-6735
• Description of Target: CDH7 is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures.This gene is a type II classical cadherin from the cadherin superfamily. The encoded membrane protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures. Alternative splicing in the 5' UTR of this gene yields variant transcripts encoding the same protein.
• Protein Interactions: FGF21; CDH9; CDH7; CDH12; CDH6; CTNNB1; CDH15;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CDH7 (ARP46435_P050) antibody is Catalog # AAP46435 (Previous Catalog # AAPS18301)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CDH7
• Uniprot ID: Q9ULB5
• Protein Name: Cadherin-7
• Protein Accession #: NP_004352
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004361
• Tested Species Reactivity: Human
• Gene Symbol: CDH7
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-CDH7 Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate