SEMA4F Antibody - N-terminal region : FITC (ARP46421_P050-FITC)

Data Sheet
 
Product Number ARP46421_P050-FITC
Product Page www.avivasysbio.com/sema4f-antibody-n-terminal-region-fitc-arp46421-p050-fitc.html
Name SEMA4F Antibody - N-terminal region : FITC (ARP46421_P050-FITC)
Protein Size (# AA) 615 amino acids
Molecular Weight 67kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 10505
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F
Alias Symbols S4F, SEMAM, SEMAW, M-SEMA, PRO2353, m-Sema-M
Peptide Sequence Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.
Protein Interactions DLG4; NRP2;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-SEMA4F (ARP46421_P050-FITC) antibody
Blocking Peptide For anti-SEMA4F (ARP46421_P050-FITC) antibody is Catalog # AAP46421 (Previous Catalog # AAPS18111)
Immunogen The immunogen is a synthetic peptide directed towards the n terminal region of human SEMA4F
Uniprot ID O95754-2
Protein Name Semaphorin-4F
Protein Accession # AAH18361
Purification Affinity Purified
Nucleotide Accession # NM_004263
Gene Symbol SEMA4F
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com